Packages 
Package Description
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.annotations  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.breadcrumb  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.breadcrumb.impl  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.checkout.steps  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.checkout.steps.validation  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.constants  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.controllers  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.controllers.cms  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.controllers.pages  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.controllers.pages.checkout.steps  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.controllers.util  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.forms  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.forms.payment  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.forms.payment.impl  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.forms.validation  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.forms.verification  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.forms.verification.impl  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.history  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.history.impl  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.interceptors  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.security  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.security.impl  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.strategy  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.strategy.impl  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.tags  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.util  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.variants  
acceleratorstorefrontcommons.de.hybris.platform.acceleratorstorefrontcommons.variants.impl  
com.hybris.backoffice  
com.hybris.backoffice.auditreport.imp  
com.hybris.backoffice.bulkedit  
com.hybris.backoffice.bulkedit.renderer  
com.hybris.backoffice.cache  
com.hybris.backoffice.cache.impl  
com.hybris.backoffice.catalogversioneventhandling  
com.hybris.backoffice.catalogversioneventhandling.impl  
com.hybris.backoffice.cockpitng  
com.hybris.backoffice.cockpitng.classification.labels.impl  
com.hybris.backoffice.cockpitng.core.resolvers  
com.hybris.backoffice.cockpitng.core.user.impl  
com.hybris.backoffice.cockpitng.dataaccess.facades.clone  
com.hybris.backoffice.cockpitng.dataaccess.facades.common  
com.hybris.backoffice.cockpitng.dataaccess.facades.object  
com.hybris.backoffice.cockpitng.dataaccess.facades.object.dataquality.impl  
com.hybris.backoffice.cockpitng.dataaccess.facades.object.savedvalues  
com.hybris.backoffice.cockpitng.dataaccess.facades.object.validation  
com.hybris.backoffice.cockpitng.dataaccess.facades.object.validation.impl  
com.hybris.backoffice.cockpitng.dataaccess.facades.permissions  
com.hybris.backoffice.cockpitng.dataaccess.facades.permissions.custom  
com.hybris.backoffice.cockpitng.dataaccess.facades.permissions.custom.impl  
com.hybris.backoffice.cockpitng.dataaccess.facades.search  
com.hybris.backoffice.cockpitng.dataaccess.facades.type  
com.hybris.backoffice.cockpitng.dataaccess.facades.type.expression  
com.hybris.backoffice.cockpitng.dnd  
com.hybris.backoffice.cockpitng.dnd.handlers  
com.hybris.backoffice.cockpitng.dnd.validators  
com.hybris.backoffice.cockpitng.editorarea.dynamicforms  
com.hybris.backoffice.cockpitng.events  
com.hybris.backoffice.cockpitng.json  
com.hybris.backoffice.cockpitng.json.impl  
com.hybris.backoffice.cockpitng.modules  
com.hybris.backoffice.cockpitng.search  
com.hybris.backoffice.cockpitng.search.builder  
com.hybris.backoffice.cockpitng.search.builder.impl  
com.hybris.backoffice.cockpitng.services.media.impl  
com.hybris.backoffice.cockpitng.user  
com.hybris.backoffice.cockpitng.user.cache  
com.hybris.backoffice.cockpitng.user.cache.impl  
com.hybris.backoffice.cockpitng.util  
com.hybris.backoffice.cockpitng.util.impl  
com.hybris.backoffice.cockpitng.util.labels  
com.hybris.backoffice.compare  
com.hybris.backoffice.config  
com.hybris.backoffice.config.impl  
com.hybris.backoffice.config.zk.au  
com.hybris.backoffice.constants  
com.hybris.backoffice.cronjob  
com.hybris.backoffice.daos  
com.hybris.backoffice.daos.impl  
com.hybris.backoffice.dates  
com.hybris.backoffice.editorarea  
com.hybris.backoffice.engine.operations.impl  
com.hybris.backoffice.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
com.hybris.backoffice.events  
com.hybris.backoffice.events.processes  
com.hybris.backoffice.events.sync  
com.hybris.backoffice.excel  
com.hybris.backoffice.excel.classification  
com.hybris.backoffice.excel.data  
com.hybris.backoffice.excel.export.wizard  
com.hybris.backoffice.excel.export.wizard.provider  
com.hybris.backoffice.excel.export.wizard.renderer  
com.hybris.backoffice.excel.export.wizard.renderer.attributechooser  
com.hybris.backoffice.excel.exporting  
com.hybris.backoffice.excel.exporting.data  
com.hybris.backoffice.excel.exporting.data.filter  
com.hybris.backoffice.excel.imp  
com.hybris.backoffice.excel.imp.wizard  
com.hybris.backoffice.excel.imp.wizard.renderer  
com.hybris.backoffice.excel.importing  
com.hybris.backoffice.excel.importing.data  
com.hybris.backoffice.excel.importing.parser  
com.hybris.backoffice.excel.importing.parser.matcher  
com.hybris.backoffice.excel.importing.parser.splitter  
com.hybris.backoffice.excel.integration  
com.hybris.backoffice.excel.jobs  
com.hybris.backoffice.excel.template  
com.hybris.backoffice.excel.template.cell  
com.hybris.backoffice.excel.template.filter  
com.hybris.backoffice.excel.template.header  
com.hybris.backoffice.excel.template.mapper  
com.hybris.backoffice.excel.template.populator  
com.hybris.backoffice.excel.template.populator.appender  
com.hybris.backoffice.excel.template.populator.descriptor  
com.hybris.backoffice.excel.template.populator.extractor  
com.hybris.backoffice.excel.template.populator.typesheet  
com.hybris.backoffice.excel.template.sheet  
com.hybris.backoffice.excel.template.workbook  
com.hybris.backoffice.excel.translators  
com.hybris.backoffice.excel.translators.classification  
com.hybris.backoffice.excel.translators.generic  
com.hybris.backoffice.excel.translators.generic.factory  
com.hybris.backoffice.excel.translators.media  
com.hybris.backoffice.excel.util  
com.hybris.backoffice.excel.validators  
com.hybris.backoffice.excel.validators.classification  
com.hybris.backoffice.excel.validators.data  
com.hybris.backoffice.excel.validators.engine  
com.hybris.backoffice.excel.validators.engine.converters  
com.hybris.backoffice.excel.validators.util  
com.hybris.backoffice.filter.responseheaders  
com.hybris.backoffice.i18n  
com.hybris.backoffice.jalo  
com.hybris.backoffice.jalo.user  
com.hybris.backoffice.labels  
com.hybris.backoffice.labels.cache.impl  
com.hybris.backoffice.labels.impl  
com.hybris.backoffice.labels.labelproviders  
com.hybris.backoffice.labels.renderers  
com.hybris.backoffice.listeners  
com.hybris.backoffice.localization  
com.hybris.backoffice.mobile.filter  
com.hybris.backoffice.model
Contains generated models for each type of com.hybris.backoffice.jalo package.
com.hybris.backoffice.model.user
Contains generated models for each type of com.hybris.backoffice.jalo.user package.
com.hybris.backoffice.proxy  
com.hybris.backoffice.renderer  
com.hybris.backoffice.renderer.attributeschooser  
com.hybris.backoffice.renderer.utils  
com.hybris.backoffice.search.adapters.conditions.product  
com.hybris.backoffice.search.aspects  
com.hybris.backoffice.search.cache  
com.hybris.backoffice.search.cache.impl  
com.hybris.backoffice.search.core.search  
com.hybris.backoffice.search.daos  
com.hybris.backoffice.search.daos.impl  
com.hybris.backoffice.search.dataaccess.facades  
com.hybris.backoffice.search.events  
com.hybris.backoffice.search.services  
com.hybris.backoffice.search.services.impl  
com.hybris.backoffice.search.setup  
com.hybris.backoffice.search.setup.impl  
com.hybris.backoffice.search.utils  
com.hybris.backoffice.searchservices.aspects  
com.hybris.backoffice.searchservices.cache.impl  
com.hybris.backoffice.searchservices.constants  
com.hybris.backoffice.searchservices.daos  
com.hybris.backoffice.searchservices.daos.impl  
com.hybris.backoffice.searchservices.dataaccess.facades  
com.hybris.backoffice.searchservices.events  
com.hybris.backoffice.searchservices.indexer.impl  
com.hybris.backoffice.searchservices.jalo  
com.hybris.backoffice.searchservices.locale  
com.hybris.backoffice.searchservices.model
Contains generated models for each type of com.hybris.backoffice.searchservices.jalo package.
com.hybris.backoffice.searchservices.populators  
com.hybris.backoffice.searchservices.providers.impl  
com.hybris.backoffice.searchservices.services.impl  
com.hybris.backoffice.searchservices.setup  
com.hybris.backoffice.searchservices.setup.impl  
com.hybris.backoffice.security  
com.hybris.backoffice.selenium.remote  
com.hybris.backoffice.solrsearch.adapters.conditions.product  
com.hybris.backoffice.solrsearch.aspects  
com.hybris.backoffice.solrsearch.cache  
com.hybris.backoffice.solrsearch.cache.impl  
com.hybris.backoffice.solrsearch.constants  
com.hybris.backoffice.solrsearch.converters  
com.hybris.backoffice.solrsearch.converters.impl  
com.hybris.backoffice.solrsearch.core.config  
com.hybris.backoffice.solrsearch.core.search  
com.hybris.backoffice.solrsearch.daos  
com.hybris.backoffice.solrsearch.daos.impl  
com.hybris.backoffice.solrsearch.dataaccess  
com.hybris.backoffice.solrsearch.dataaccess.facades  
com.hybris.backoffice.solrsearch.decorators  
com.hybris.backoffice.solrsearch.decorators.impl  
com.hybris.backoffice.solrsearch.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
com.hybris.backoffice.solrsearch.events  
com.hybris.backoffice.solrsearch.indexer.cron  
com.hybris.backoffice.solrsearch.indexer.impl  
com.hybris.backoffice.solrsearch.indexing  
com.hybris.backoffice.solrsearch.jalo  
com.hybris.backoffice.solrsearch.locale  
com.hybris.backoffice.solrsearch.model
Contains generated models for each type of com.hybris.backoffice.solrsearch.jalo package.
com.hybris.backoffice.solrsearch.populators  
com.hybris.backoffice.solrsearch.populators.conditionvalueconverters  
com.hybris.backoffice.solrsearch.providers  
com.hybris.backoffice.solrsearch.providers.impl  
com.hybris.backoffice.solrsearch.resolvers  
com.hybris.backoffice.solrsearch.selenium.remote  
com.hybris.backoffice.solrsearch.services  
com.hybris.backoffice.solrsearch.services.impl  
com.hybris.backoffice.solrsearch.setup  
com.hybris.backoffice.solrsearch.setup.impl  
com.hybris.backoffice.solrsearch.utils  
com.hybris.backoffice.solrsearch.validators  
com.hybris.backoffice.spring  
com.hybris.backoffice.spring.security  
com.hybris.backoffice.sync  
com.hybris.backoffice.sync.decorators  
com.hybris.backoffice.sync.facades  
com.hybris.backoffice.sync.renderers  
com.hybris.backoffice.sync.updaters  
com.hybris.backoffice.tree  
com.hybris.backoffice.tree.model  
com.hybris.backoffice.tree.model.helper  
com.hybris.backoffice.user  
com.hybris.backoffice.variants  
com.hybris.backoffice.widgets.accountsettings  
com.hybris.backoffice.widgets.accountsettings.changepassword  
com.hybris.backoffice.widgets.accountsettings.changepassword.wizard  
com.hybris.backoffice.widgets.actions.audit  
com.hybris.backoffice.widgets.actions.bulkedit  
com.hybris.backoffice.widgets.actions.enumeration  
com.hybris.backoffice.widgets.actions.excel  
com.hybris.backoffice.widgets.actions.locking  
com.hybris.backoffice.widgets.actions.sync  
com.hybris.backoffice.widgets.actions.workflow  
com.hybris.backoffice.widgets.catalog  
com.hybris.backoffice.widgets.controller.bookmark  
com.hybris.backoffice.widgets.itemcomments  
com.hybris.backoffice.widgets.itemcomments.renderer  
com.hybris.backoffice.widgets.processes  
com.hybris.backoffice.widgets.processes.renderer  
com.hybris.backoffice.widgets.processes.settings  
com.hybris.backoffice.widgets.processes.updater  
com.hybris.backoffice.widgets.scriptexecutor  
com.hybris.backoffice.widgets.searchadapters  
com.hybris.backoffice.widgets.searchadapters.conditions  
com.hybris.backoffice.widgets.searchadapters.conditions.products  
com.hybris.backoffice.widgets.searchadapters.workflows  
com.hybris.backoffice.widgets.selectivesync  
com.hybris.backoffice.widgets.selectivesync.detailsview  
com.hybris.backoffice.widgets.selectivesync.legend  
com.hybris.backoffice.widgets.selectivesync.renderer  
com.hybris.backoffice.widgets.selectivesync.tree  
com.hybris.backoffice.widgets.stats.productstats  
com.hybris.backoffice.widgets.syncpopup  
com.hybris.backoffice.widgets.synctracker  
com.hybris.backoffice.widgets.synctracker.handlers  
com.hybris.backoffice.widgets.workflowactionadapter  
com.hybris.backoffice.widgets.workflowactions  
com.hybris.backoffice.widgets.workflowactions.renderer  
com.hybris.backoffice.widgets.workflowdetails  
com.hybris.backoffice.widgets.workflowdetails.renderer  
com.hybris.backoffice.widgets.workflows  
com.hybris.backoffice.widgets.workflows.renderer  
com.hybris.backoffice.widgets.workflowsearch  
com.hybris.backoffice.wizard  
com.hybris.backoffice.workflow  
com.hybris.backoffice.workflow.constants  
com.hybris.backoffice.workflow.designer  
com.hybris.backoffice.workflow.designer.dto  
com.hybris.backoffice.workflow.designer.form  
com.hybris.backoffice.workflow.designer.handler  
com.hybris.backoffice.workflow.designer.handler.connection  
com.hybris.backoffice.workflow.designer.handler.connection.validator  
com.hybris.backoffice.workflow.designer.handler.create  
com.hybris.backoffice.workflow.designer.handler.retriever  
com.hybris.backoffice.workflow.designer.persistence  
com.hybris.backoffice.workflow.designer.pojo  
com.hybris.backoffice.workflow.designer.renderer  
com.hybris.backoffice.workflow.designer.services  
com.hybris.backoffice.workflow.designer.validation  
com.hybris.backoffice.workflow.flow  
com.hybris.backoffice.workflow.impl  
com.hybris.backoffice.workflow.renderer  
com.hybris.backoffice.workflow.renderer.actionexecutors  
com.hybris.backoffice.workflow.renderer.predicates  
com.hybris.backoffice.workflow.wizard  
com.hybris.cis.api.test.util  
com.hybris.cis.client  
com.hybris.cis.client.avs  
com.hybris.cis.client.avs.models  
com.hybris.cis.client.constants  
com.hybris.cis.client.fraud  
com.hybris.cis.client.fraud.exception  
com.hybris.cis.client.fraud.models  
com.hybris.cis.client.geolocation  
com.hybris.cis.client.geolocation.exception  
com.hybris.cis.client.geolocation.models  
com.hybris.cis.client.jalo  
com.hybris.cis.client.mock  
com.hybris.cis.client.payment  
com.hybris.cis.client.payment.exception  
com.hybris.cis.client.payment.models  
com.hybris.cis.client.rest.avs.mock  
com.hybris.cis.client.rest.core.avs  
com.hybris.cis.client.rest.core.fraud  
com.hybris.cis.client.rest.core.geolocation  
com.hybris.cis.client.rest.core.payment  
com.hybris.cis.client.rest.core.shipping  
com.hybris.cis.client.rest.core.tax  
com.hybris.cis.client.rest.fraud.mock  
com.hybris.cis.client.rest.geolocation.mock  
com.hybris.cis.client.rest.payment.mock  
com.hybris.cis.client.rest.shipping.mock  
com.hybris.cis.client.rest.tax.mock  
com.hybris.cis.client.shared.exception  
com.hybris.cis.client.shared.exception.codes  
com.hybris.cis.client.shared.models  
com.hybris.cis.client.shipping  
com.hybris.cis.client.shipping.exception  
com.hybris.cis.client.shipping.models  
com.hybris.cis.client.tax  
com.hybris.cis.client.tax.exception  
com.hybris.cis.client.tax.models  
com.hybris.cis.client.tax.util  
com.hybris.cis.service  
com.hybris.cis.service.impl  
com.hybris.classificationgroupsservices  
com.hybris.classificationgroupsservices.constants  
com.hybris.classificationgroupsservices.handlers  
com.hybris.classificationgroupsservices.interceptors  
com.hybris.classificationgroupsservices.interceptors.classattributeassignment  
com.hybris.classificationgroupsservices.interceptors.classificationattribute  
com.hybris.classificationgroupsservices.interceptors.classificationclass  
com.hybris.classificationgroupsservices.jalo  
com.hybris.classificationgroupsservices.model
Contains generated models for each type of com.hybris.classificationgroupsservices.jalo package.
com.hybris.classificationgroupsservices.services  
com.hybris.commons.client  
com.hybris.convert.storefrontsampledata.jalo  
com.hybris.datahub.core.config  
com.hybris.datahub.core.config.impl  
com.hybris.datahub.core.constants  
com.hybris.datahub.core.data  
com.hybris.datahub.core.dto  
com.hybris.datahub.core.event  
com.hybris.datahub.core.facades  
com.hybris.datahub.core.facades.impl  
com.hybris.datahub.core.facades.impl.converter  
com.hybris.datahub.core.io  
com.hybris.datahub.core.rest  
com.hybris.datahub.core.rest.client  
com.hybris.datahub.core.rest.controllers  
com.hybris.datahub.core.services  
com.hybris.datahub.core.services.impl  
com.hybris.datahub.core.tasks  
com.hybris.datahub.core.util  
com.hybris.hybrisdatasupplierbackoffice  
com.hybris.hybrisdatasupplierbackoffice.constants  
com.hybris.hybrisdatasupplierbackoffice.jalo  
com.hybris.hybrisdatasupplierbackoffice.services  
com.hybris.merchandising  
com.hybris.merchandising.addon.component.renderer  
com.hybris.merchandising.addon.jalo  
com.hybris.merchandising.addon.model
Contains generated models for each type of com.hybris.merchandising.addon.jalo package.
com.hybris.merchandising.client  
com.hybris.merchandising.config  
com.hybris.merchandising.constants  
com.hybris.merchandising.context  
com.hybris.merchandising.context.impl  
com.hybris.merchandising.controller  
com.hybris.merchandising.controllers  
com.hybris.merchandising.converters.populators  
com.hybris.merchandising.dao  
com.hybris.merchandising.dao.impl  
com.hybris.merchandising.dto  
com.hybris.merchandising.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
com.hybris.merchandising.exceptions  
com.hybris.merchandising.exporter  
com.hybris.merchandising.function  
com.hybris.merchandising.indexer.listeners  
com.hybris.merchandising.interceptor  
com.hybris.merchandising.interceptors  
com.hybris.merchandising.jalo  
com.hybris.merchandising.listeners  
com.hybris.merchandising.metric.rollup.strategies  
com.hybris.merchandising.metric.rollup.strategies.impl  
com.hybris.merchandising.model
Contains generated models for each type of com.hybris.merchandising.jalo package.
com.hybris.merchandising.processor  
com.hybris.merchandising.processor.impl  
com.hybris.merchandising.service  
com.hybris.merchandising.service.impl  
com.hybris.merchandising.storefrontsampledata.constants  
com.hybris.merchandising.storefrontsampledata.jalo  
com.hybris.pcmbackoffice.actions.removelist  
com.hybris.pcmbackoffice.classificationgroupsbackoffice.facades  
com.hybris.pcmbackoffice.classificationgroupsbackoffice.renderers  
com.hybris.pcmbackoffice.renderers  
com.hybris.pcmbackoffice.widgets.charts.facetchart  
com.hybris.pcmbackoffice.widgets.charts.facetchart.filter  
com.hybris.pcmbackoffice.widgets.contextpopulator  
com.hybris.pcmbackoffice.widgets.shortcuts  
com.hybris.platform.merchandising.yaas  
com.hybris.samlssobackoffice  
com.hybris.samlssobackoffice.constants  
com.hybris.samlssobackoffice.jalo  
com.hybris.yprofile.common  
com.hybris.yprofile.consent.cookie  
com.hybris.yprofile.consent.filters  
com.hybris.yprofile.consent.services  
com.hybris.yprofile.constants  
com.hybris.yprofile.dto  
com.hybris.yprofile.dto.cookie  
com.hybris.yprofile.exceptions  
com.hybris.yprofile.jalo  
com.hybris.yprofile.listeners  
com.hybris.yprofile.populators  
com.hybris.yprofile.profiletagaddon.component.renderer  
com.hybris.yprofile.profiletagaddon.constants  
com.hybris.yprofile.profiletagaddon.controllers  
com.hybris.yprofile.profiletagaddon.interceptors.beforeview  
com.hybris.yprofile.profiletagaddon.jalo  
com.hybris.yprofile.profiletagaddon.model
Contains generated models for each type of com.hybris.yprofile.profiletagaddon.jalo package.
com.hybris.yprofile.rest.clients  
com.hybris.yprofile.services  
com.hybris.yprofile.services.customer  
com.hybris.yprofile.services.impl  
com.hybris.yprofile.services.order  
com.sap.document.sap.soap.functions.mc_style  
com.sap.smartedittools.constants  
com.sap.smartedittools.jalo  
de.hybris.adaptivesearchfacades.data  
de.hybris.adaptivesearchwebservices.dto  
de.hybris.ant.taskdefs  
de.hybris.ant.taskdefs.assembling  
de.hybris.ant.taskdefs.compiling  
de.hybris.ant.taskdefs.compiling.checkitemsxml  
de.hybris.ant.taskdefs.docker  
de.hybris.ant.taskdefs.gradle  
de.hybris.ant.taskdefs.init  
de.hybris.ant.taskdefs.internal  
de.hybris.ant.taskdefs.internal.context  
de.hybris.ant.taskdefs.migration  
de.hybris.ant.taskdefs.ProductionPackageValidation  
de.hybris.ant.taskdefs.ProductionPackageValidation.impl  
de.hybris.ant.taskdefs.yunit  
de.hybris.ant.util  
de.hybris.basecommerce.jalo  
de.hybris.bootstrap.annotations  
de.hybris.bootstrap.beangenerator  
de.hybris.bootstrap.beangenerator.definitions.model  
de.hybris.bootstrap.beangenerator.definitions.view  
de.hybris.bootstrap.beangenerator.definitions.xml  
de.hybris.bootstrap.beangenerator.postprocessors  
de.hybris.bootstrap.beangenerator.validators  
de.hybris.bootstrap.codegenerator  
de.hybris.bootstrap.codegenerator.jalo  
de.hybris.bootstrap.codegenerator.model  
de.hybris.bootstrap.codegenerator.model.enums  
de.hybris.bootstrap.codegenerator.platformwebservices  
de.hybris.bootstrap.codegenerator.platformwebservices.dto  
de.hybris.bootstrap.codegenerator.platformwebservices.resource  
de.hybris.bootstrap.config  
de.hybris.bootstrap.config.tenants  
de.hybris.bootstrap.ddl  
de.hybris.bootstrap.ddl.adjusters  
de.hybris.bootstrap.ddl.dbtypesystem  
de.hybris.bootstrap.ddl.dbtypesystem.impl  
de.hybris.bootstrap.ddl.jdbc  
de.hybris.bootstrap.ddl.model  
de.hybris.bootstrap.ddl.pk  
de.hybris.bootstrap.ddl.pk.impl  
de.hybris.bootstrap.ddl.sql  
de.hybris.bootstrap.ddl.tools  
de.hybris.bootstrap.ddl.tools.persistenceinfo  
de.hybris.bootstrap.loader  
de.hybris.bootstrap.loader.impl  
de.hybris.bootstrap.loader.metrics  
de.hybris.bootstrap.loader.metrics.internal  
de.hybris.bootstrap.loader.rule  
de.hybris.bootstrap.loader.rule.internal  
de.hybris.bootstrap.osnotify  
de.hybris.bootstrap.osnotify.impl  
de.hybris.bootstrap.testclasses  
de.hybris.bootstrap.testclasses.samples  
de.hybris.bootstrap.tomcat.cookieprocessor  
de.hybris.bootstrap.typesystem  
de.hybris.bootstrap.typesystem.dto  
de.hybris.bootstrap.typesystem.jaxb  
de.hybris.bootstrap.typesystem.xml  
de.hybris.bootstrap.util  
de.hybris.bootstrap.xml  
de.hybris.cmssmartedit.constants  
de.hybris.cmssmartedit.jalo  
de.hybris.constants  
de.hybris.datasupplier  
de.hybris.datasupplier.collectors  
de.hybris.datasupplier.collectors.impl  
de.hybris.datasupplier.constants  
de.hybris.datasupplier.data  
de.hybris.datasupplier.exceptions  
de.hybris.datasupplier.facades  
de.hybris.datasupplier.facades.impl  
de.hybris.datasupplier.generator.hybris.collector.sc  
de.hybris.datasupplier.generator.hybris.data  
de.hybris.datasupplier.generator.tomcat  
de.hybris.datasupplier.generator.tomcat.collector  
de.hybris.datasupplier.generator.tomcat.collector.config  
de.hybris.datasupplier.generator.tomcat.collector.sc  
de.hybris.datasupplier.generator.tomcat.data  
de.hybris.datasupplier.generator.tomcat.gen  
de.hybris.datasupplier.generator.tomcat.utils  
de.hybris.datasupplier.jalo  
de.hybris.datasupplier.jobs  
de.hybris.datasupplier.model
Contains generated models for each type of de.hybris.datasupplier.jalo package.
de.hybris.datasupplier.services  
de.hybris.datasupplier.services.genericdatasupplier  
de.hybris.datasupplier.services.genericdatasupplier.impl  
de.hybris.datasupplier.services.impl  
de.hybris.datasupplier.utils  
de.hybris.deltadetection  
de.hybris.deltadetection.constants  
de.hybris.deltadetection.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.deltadetection.exception  
de.hybris.deltadetection.impl  
de.hybris.deltadetection.interceptors  
de.hybris.deltadetection.jalo  
de.hybris.deltadetection.jobs  
de.hybris.deltadetection.model
Contains generated models for each type of de.hybris.deltadetection.jalo package.
de.hybris.deltadetection.tasks  
de.hybris.e2e  
de.hybris.e2e.hybrisrootcauseanalysis  
de.hybris.e2e.hybrisrootcauseanalysis.changeanalysis  
de.hybris.e2e.hybrisrootcauseanalysis.changeanalysis.job  
de.hybris.e2e.hybrisrootcauseanalysis.changeanalysis.services  
de.hybris.e2e.hybrisrootcauseanalysis.changeanalysis.services.impl  
de.hybris.e2e.hybrisrootcauseanalysis.constants  
de.hybris.e2e.hybrisrootcauseanalysis.exceptionanalysis  
de.hybris.e2e.hybrisrootcauseanalysis.exceptionanalysis.constants  
de.hybris.e2e.hybrisrootcauseanalysis.jalo  
de.hybris.e2e.hybrisrootcauseanalysis.technicalmonitoring.controllers  
de.hybris.e2e.hybrisrootcauseanalysis.technicalmonitoring.services  
de.hybris.e2e.hybrisrootcauseanalysis.technicalmonitoring.services.impl  
de.hybris.e2e.hybrisrootcauseanalysis.utils  
de.hybris.e2e.jalo  
de.hybris.e2e.transport  
de.hybris.e2e.transport.constants  
de.hybris.e2e.transport.cts  
de.hybris.e2e.transport.cts.impl  
de.hybris.e2e.transport.jalo  
de.hybris.e2e.transport.jalo.decorator  
de.hybris.e2e.transport.utils  
de.hybris.eventtracking.model.constants  
de.hybris.eventtracking.model.events  
de.hybris.eventtracking.model.jalo  
de.hybris.eventtracking.publisher.constants  
de.hybris.eventtracking.publisher.csv.converters  
de.hybris.eventtracking.publisher.csv.model  
de.hybris.eventtracking.publisher.jalo  
de.hybris.eventtracking.publisher.listeners  
de.hybris.eventtracking.services.constants  
de.hybris.eventtracking.services.converters  
de.hybris.eventtracking.services.exceptions  
de.hybris.eventtracking.services.handlers  
de.hybris.eventtracking.services.jalo  
de.hybris.eventtracking.services.populators  
de.hybris.eventtracking.services.validators  
de.hybris.eventtracking.ws.constants  
de.hybris.eventtracking.ws.controllers  
de.hybris.eventtracking.ws.controllers.rest  
de.hybris.eventtracking.ws.filters  
de.hybris.eventtracking.ws.jalo  
de.hybris.eventtracking.ws.services  
de.hybris.jalo  
de.hybris.order.calculation  
de.hybris.order.calculation.constants  
de.hybris.order.calculation.domain  
de.hybris.order.calculation.exception  
de.hybris.order.calculation.money  
de.hybris.order.calculation.strategies  
de.hybris.order.calculation.strategies.impl  
de.hybris.ouath2.openidconnect.dto  
de.hybris.platform  
de.hybris.platform.acceleratorcms.action.renderer.impl  
de.hybris.platform.acceleratorcms.component.cache  
de.hybris.platform.acceleratorcms.component.cache.impl  
de.hybris.platform.acceleratorcms.component.cloning.predicate  
de.hybris.platform.acceleratorcms.component.container  
de.hybris.platform.acceleratorcms.component.container.impl  
de.hybris.platform.acceleratorcms.component.renderer  
de.hybris.platform.acceleratorcms.component.renderer.impl  
de.hybris.platform.acceleratorcms.component.slot  
de.hybris.platform.acceleratorcms.component.slot.impl  
de.hybris.platform.acceleratorcms.constants  
de.hybris.platform.acceleratorcms.context  
de.hybris.platform.acceleratorcms.context.impl  
de.hybris.platform.acceleratorcms.data  
de.hybris.platform.acceleratorcms.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.acceleratorcms.evaluator  
de.hybris.platform.acceleratorcms.jalo  
de.hybris.platform.acceleratorcms.jalo.actions  
de.hybris.platform.acceleratorcms.jalo.components  
de.hybris.platform.acceleratorcms.jalo.restrictions  
de.hybris.platform.acceleratorcms.model
Contains generated models for each type of de.hybris.platform.acceleratorcms.jalo package.
de.hybris.platform.acceleratorcms.model.actions
Contains generated models for each type of de.hybris.platform.acceleratorcms.jalo.actions package.
de.hybris.platform.acceleratorcms.model.components
Contains generated models for each type of de.hybris.platform.acceleratorcms.jalo.components package.
de.hybris.platform.acceleratorcms.model.restrictions
Contains generated models for each type of de.hybris.platform.acceleratorcms.jalo.restrictions package.
de.hybris.platform.acceleratorcms.preview.strategies  
de.hybris.platform.acceleratorcms.preview.strategies.impl  
de.hybris.platform.acceleratorcms.productcarousel  
de.hybris.platform.acceleratorcms.productcarousel.impl  
de.hybris.platform.acceleratorcms.services  
de.hybris.platform.acceleratorcms.services.impl  
de.hybris.platform.acceleratorcms.setup  
de.hybris.platform.acceleratorcms.tags2  
de.hybris.platform.acceleratorcms.utils  
de.hybris.platform.acceleratorfacades.basestores.converters.populator  
de.hybris.platform.acceleratorfacades.cart.action  
de.hybris.platform.acceleratorfacades.cart.action.exceptions  
de.hybris.platform.acceleratorfacades.cart.action.impl  
de.hybris.platform.acceleratorfacades.cart.action.populator  
de.hybris.platform.acceleratorfacades.cart.data  
de.hybris.platform.acceleratorfacades.cartfileupload  
de.hybris.platform.acceleratorfacades.cartfileupload.impl  
de.hybris.platform.acceleratorfacades.cmsitems.attributeconverters  
de.hybris.platform.acceleratorfacades.cmsitems.attributevalidators  
de.hybris.platform.acceleratorfacades.cmsitems.populator  
de.hybris.platform.acceleratorfacades.cmsitems.predicates  
de.hybris.platform.acceleratorfacades.cmsitems.validators  
de.hybris.platform.acceleratorfacades.component.synchronization.itemvisitors  
de.hybris.platform.acceleratorfacades.component.synchronization.itemvisitors.impl  
de.hybris.platform.acceleratorfacades.constants  
de.hybris.platform.acceleratorfacades.csv  
de.hybris.platform.acceleratorfacades.csv.impl  
de.hybris.platform.acceleratorfacades.customerlocation  
de.hybris.platform.acceleratorfacades.customerlocation.impl  
de.hybris.platform.acceleratorfacades.device  
de.hybris.platform.acceleratorfacades.device.data  
de.hybris.platform.acceleratorfacades.device.impl  
de.hybris.platform.acceleratorfacades.device.populators  
de.hybris.platform.acceleratorfacades.email  
de.hybris.platform.acceleratorfacades.email.impl  
de.hybris.platform.acceleratorfacades.flow  
de.hybris.platform.acceleratorfacades.flow.impl  
de.hybris.platform.acceleratorfacades.futurestock  
de.hybris.platform.acceleratorfacades.futurestock.impl  
de.hybris.platform.acceleratorfacades.order  
de.hybris.platform.acceleratorfacades.order.checkout  
de.hybris.platform.acceleratorfacades.order.data  
de.hybris.platform.acceleratorfacades.order.impl  
de.hybris.platform.acceleratorfacades.order.populators  
de.hybris.platform.acceleratorfacades.ordergridform  
de.hybris.platform.acceleratorfacades.ordergridform.converters.populators  
de.hybris.platform.acceleratorfacades.ordergridform.impl  
de.hybris.platform.acceleratorfacades.ordergridform.impl.converters.populators  
de.hybris.platform.acceleratorfacades.pages.populators.data  
de.hybris.platform.acceleratorfacades.pages.populators.model  
de.hybris.platform.acceleratorfacades.pages.services  
de.hybris.platform.acceleratorfacades.payment  
de.hybris.platform.acceleratorfacades.payment.data  
de.hybris.platform.acceleratorfacades.payment.impl  
de.hybris.platform.acceleratorfacades.payment.populators  
de.hybris.platform.acceleratorfacades.product.converters.populator  
de.hybris.platform.acceleratorfacades.product.converts.populator  
de.hybris.platform.acceleratorfacades.product.data  
de.hybris.platform.acceleratorfacades.productcarousel  
de.hybris.platform.acceleratorfacades.productcarousel.impl  
de.hybris.platform.acceleratorfacades.quote  
de.hybris.platform.acceleratorfacades.storelocator.populators  
de.hybris.platform.acceleratorfacades.urlencoder  
de.hybris.platform.acceleratorfacades.urlencoder.attributes  
de.hybris.platform.acceleratorfacades.urlencoder.data  
de.hybris.platform.acceleratorfacades.urlencoder.impl  
de.hybris.platform.acceleratorocc.constants  
de.hybris.platform.acceleratorocc.controllers  
de.hybris.platform.acceleratorocc.controllers.v2  
de.hybris.platform.acceleratorocc.cronjob  
de.hybris.platform.acceleratorocc.dto.payment  
de.hybris.platform.acceleratorocc.exceptions  
de.hybris.platform.acceleratorocc.jalo  
de.hybris.platform.acceleratorocc.order.hook  
de.hybris.platform.acceleratorocc.payment.dao  
de.hybris.platform.acceleratorocc.payment.dao.impl  
de.hybris.platform.acceleratorocc.payment.facade  
de.hybris.platform.acceleratorocc.payment.facade.impl  
de.hybris.platform.acceleratorocc.payment.populators.impl  
de.hybris.platform.acceleratorocc.payment.service  
de.hybris.platform.acceleratorocc.payment.service.impl  
de.hybris.platform.acceleratorocc.populators.impl  
de.hybris.platform.acceleratorocc.urlresolver.impl  
de.hybris.platform.acceleratorocc.validator  
de.hybris.platform.acceleratorservices  
de.hybris.platform.acceleratorservices.addonsupport  
de.hybris.platform.acceleratorservices.attribute  
de.hybris.platform.acceleratorservices.cartfileupload.data  
de.hybris.platform.acceleratorservices.cartfileupload.events  
de.hybris.platform.acceleratorservices.checkout.pci  
de.hybris.platform.acceleratorservices.checkout.pci.impl  
de.hybris.platform.acceleratorservices.config  
de.hybris.platform.acceleratorservices.config.impl  
de.hybris.platform.acceleratorservices.constants  
de.hybris.platform.acceleratorservices.controllers.page  
de.hybris.platform.acceleratorservices.cronjob  
de.hybris.platform.acceleratorservices.customer  
de.hybris.platform.acceleratorservices.customer.impl  
de.hybris.platform.acceleratorservices.data  
de.hybris.platform.acceleratorservices.dataexport.generic  
de.hybris.platform.acceleratorservices.dataexport.generic.config  
de.hybris.platform.acceleratorservices.dataexport.generic.event  
de.hybris.platform.acceleratorservices.dataexport.generic.impl  
de.hybris.platform.acceleratorservices.dataexport.generic.output.csv  
de.hybris.platform.acceleratorservices.dataexport.generic.query  
de.hybris.platform.acceleratorservices.dataexport.generic.query.impl  
de.hybris.platform.acceleratorservices.dataexport.googlelocal.converter  
de.hybris.platform.acceleratorservices.dataexport.googlelocal.model  
de.hybris.platform.acceleratorservices.dataimport.batch  
de.hybris.platform.acceleratorservices.dataimport.batch.aop  
de.hybris.platform.acceleratorservices.dataimport.batch.converter  
de.hybris.platform.acceleratorservices.dataimport.batch.converter.impl  
de.hybris.platform.acceleratorservices.dataimport.batch.converter.mapping  
de.hybris.platform.acceleratorservices.dataimport.batch.converter.mapping.impl  
de.hybris.platform.acceleratorservices.dataimport.batch.decorator  
de.hybris.platform.acceleratorservices.dataimport.batch.stock  
de.hybris.platform.acceleratorservices.dataimport.batch.stock.impl  
de.hybris.platform.acceleratorservices.dataimport.batch.task  
de.hybris.platform.acceleratorservices.dataimport.batch.task.impl  
de.hybris.platform.acceleratorservices.dataimport.batch.util  
de.hybris.platform.acceleratorservices.document.context  
de.hybris.platform.acceleratorservices.document.dao  
de.hybris.platform.acceleratorservices.document.dao.impl  
de.hybris.platform.acceleratorservices.document.factory  
de.hybris.platform.acceleratorservices.document.factory.impl  
de.hybris.platform.acceleratorservices.document.service  
de.hybris.platform.acceleratorservices.document.service.impl  
de.hybris.platform.acceleratorservices.document.strategy  
de.hybris.platform.acceleratorservices.document.strategy.impl  
de.hybris.platform.acceleratorservices.email  
de.hybris.platform.acceleratorservices.email.dao  
de.hybris.platform.acceleratorservices.email.dao.impl  
de.hybris.platform.acceleratorservices.email.data  
de.hybris.platform.acceleratorservices.email.impl  
de.hybris.platform.acceleratorservices.email.strategy  
de.hybris.platform.acceleratorservices.email.strategy.impl  
de.hybris.platform.acceleratorservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.acceleratorservices.exceptions  
de.hybris.platform.acceleratorservices.fraud.symptom.impl  
de.hybris.platform.acceleratorservices.futurestock  
de.hybris.platform.acceleratorservices.futurestock.impl  
de.hybris.platform.acceleratorservices.jalo  
de.hybris.platform.acceleratorservices.jalo.cms2.pages  
de.hybris.platform.acceleratorservices.jalo.email  
de.hybris.platform.acceleratorservices.jalo.export  
de.hybris.platform.acceleratorservices.jalo.payment  
de.hybris.platform.acceleratorservices.jalo.process  
de.hybris.platform.acceleratorservices.jalo.promotions  
de.hybris.platform.acceleratorservices.jalo.redirect  
de.hybris.platform.acceleratorservices.metainformation  
de.hybris.platform.acceleratorservices.model
Contains generated models for each type of de.hybris.platform.acceleratorservices.jalo package.
de.hybris.platform.acceleratorservices.model.cms2.pages
Contains generated models for each type of de.hybris.platform.acceleratorservices.jalo.cms2.pages package.
de.hybris.platform.acceleratorservices.model.email
Contains generated models for each type of de.hybris.platform.acceleratorservices.jalo.email package.
de.hybris.platform.acceleratorservices.model.export
Contains generated models for each type of de.hybris.platform.acceleratorservices.jalo.export package.
de.hybris.platform.acceleratorservices.model.payment
Contains generated models for each type of de.hybris.platform.acceleratorservices.jalo.payment package.
de.hybris.platform.acceleratorservices.model.process
Contains generated models for each type of de.hybris.platform.acceleratorservices.jalo.process package.
de.hybris.platform.acceleratorservices.model.promotions
Contains generated models for each type of de.hybris.platform.acceleratorservices.jalo.promotions package.
de.hybris.platform.acceleratorservices.model.redirect
Contains generated models for each type of de.hybris.platform.acceleratorservices.jalo.redirect package.
de.hybris.platform.acceleratorservices.order  
de.hybris.platform.acceleratorservices.order.actions  
de.hybris.platform.acceleratorservices.order.dao  
de.hybris.platform.acceleratorservices.order.dao.impl  
de.hybris.platform.acceleratorservices.order.hooks  
de.hybris.platform.acceleratorservices.order.impl  
de.hybris.platform.acceleratorservices.order.strategies  
de.hybris.platform.acceleratorservices.order.strategies.impl  
de.hybris.platform.acceleratorservices.orderprocessing.jalo  
de.hybris.platform.acceleratorservices.orderprocessing.model
Contains generated models for each type of de.hybris.platform.acceleratorservices.orderprocessing.jalo package.
de.hybris.platform.acceleratorservices.ordersplitting.impl  
de.hybris.platform.acceleratorservices.ordersplitting.strategy.impl  
de.hybris.platform.acceleratorservices.payment  
de.hybris.platform.acceleratorservices.payment.constants  
de.hybris.platform.acceleratorservices.payment.cybersource.constants  
de.hybris.platform.acceleratorservices.payment.cybersource.converters.populators  
de.hybris.platform.acceleratorservices.payment.cybersource.converters.populators.request  
de.hybris.platform.acceleratorservices.payment.cybersource.converters.populators.response  
de.hybris.platform.acceleratorservices.payment.cybersource.enums  
de.hybris.platform.acceleratorservices.payment.cybersource.strategies.impl  
de.hybris.platform.acceleratorservices.payment.dao  
de.hybris.platform.acceleratorservices.payment.dao.impl  
de.hybris.platform.acceleratorservices.payment.data  
de.hybris.platform.acceleratorservices.payment.enums  
de.hybris.platform.acceleratorservices.payment.impl  
de.hybris.platform.acceleratorservices.payment.strategies  
de.hybris.platform.acceleratorservices.payment.strategies.impl  
de.hybris.platform.acceleratorservices.payment.utils  
de.hybris.platform.acceleratorservices.payment.utils.impl  
de.hybris.platform.acceleratorservices.process.email.actions  
de.hybris.platform.acceleratorservices.process.email.context  
de.hybris.platform.acceleratorservices.process.email.context.impl  
de.hybris.platform.acceleratorservices.process.fileupload  
de.hybris.platform.acceleratorservices.process.strategies  
de.hybris.platform.acceleratorservices.process.strategies.impl  
de.hybris.platform.acceleratorservices.promotions  
de.hybris.platform.acceleratorservices.promotions.dao  
de.hybris.platform.acceleratorservices.promotions.dao.impl  
de.hybris.platform.acceleratorservices.search.comparators  
de.hybris.platform.acceleratorservices.search.solrfacetsearch.provider.impl  
de.hybris.platform.acceleratorservices.site  
de.hybris.platform.acceleratorservices.site.strategies  
de.hybris.platform.acceleratorservices.site.strategies.impl  
de.hybris.platform.acceleratorservices.sitemap.data  
de.hybris.platform.acceleratorservices.sitemap.generator  
de.hybris.platform.acceleratorservices.sitemap.generator.impl  
de.hybris.platform.acceleratorservices.sitemap.populators  
de.hybris.platform.acceleratorservices.sitemap.renderer  
de.hybris.platform.acceleratorservices.solr.attribute  
de.hybris.platform.acceleratorservices.solr.keywordredirect  
de.hybris.platform.acceleratorservices.store  
de.hybris.platform.acceleratorservices.store.data  
de.hybris.platform.acceleratorservices.store.impl  
de.hybris.platform.acceleratorservices.store.pickup  
de.hybris.platform.acceleratorservices.store.pickup.impl  
de.hybris.platform.acceleratorservices.storefront.data  
de.hybris.platform.acceleratorservices.storefront.util  
de.hybris.platform.acceleratorservices.uiexperience  
de.hybris.platform.acceleratorservices.uiexperience.impl  
de.hybris.platform.acceleratorservices.urldecoder  
de.hybris.platform.acceleratorservices.urldecoder.impl  
de.hybris.platform.acceleratorservices.urlencoder  
de.hybris.platform.acceleratorservices.urlencoder.attributes  
de.hybris.platform.acceleratorservices.urlencoder.attributes.impl  
de.hybris.platform.acceleratorservices.urlencoder.impl  
de.hybris.platform.acceleratorservices.urlresolver  
de.hybris.platform.acceleratorservices.urlresolver.impl  
de.hybris.platform.acceleratorservices.util  
de.hybris.platform.acceleratorservices.util.collections  
de.hybris.platform.acceleratorservices.velocity  
de.hybris.platform.acceleratorservices.velocity.ant  
de.hybris.platform.acceleratorservices.velocity.core  
de.hybris.platform.acceleratorservices.velocity.eval  
de.hybris.platform.acceleratorservices.velocity.eval.key  
de.hybris.platform.acceleratorservices.velocity.handler  
de.hybris.platform.acceleratorservices.velocity.locale  
de.hybris.platform.acceleratorservices.velocity.resource  
de.hybris.platform.acceleratorservices.velocity.resource.name  
de.hybris.platform.acceleratorservices.velocity.resource.store  
de.hybris.platform.acceleratorservices.velocity.resource.url  
de.hybris.platform.acceleratorservices.velocity.util  
de.hybris.platform.acceleratorservices.velocity.util.standalone  
de.hybris.platform.acceleratorservices.web.payment.controllers  
de.hybris.platform.acceleratorservices.web.payment.forms  
de.hybris.platform.acceleratorservices.web.payment.validation  
de.hybris.platform.acceleratorstorefrontcommons.annotations  
de.hybris.platform.acceleratorstorefrontcommons.breadcrumb  
de.hybris.platform.acceleratorstorefrontcommons.breadcrumb.impl  
de.hybris.platform.acceleratorstorefrontcommons.checkout.steps  
de.hybris.platform.acceleratorstorefrontcommons.checkout.steps.validation  
de.hybris.platform.acceleratorstorefrontcommons.consent.data  
de.hybris.platform.acceleratorstorefrontcommons.constants  
de.hybris.platform.acceleratorstorefrontcommons.controllers  
de.hybris.platform.acceleratorstorefrontcommons.controllers.cms  
de.hybris.platform.acceleratorstorefrontcommons.controllers.pages  
de.hybris.platform.acceleratorstorefrontcommons.controllers.pages.checkout.steps  
de.hybris.platform.acceleratorstorefrontcommons.controllers.util  
de.hybris.platform.acceleratorstorefrontcommons.forms  
de.hybris.platform.acceleratorstorefrontcommons.forms.payment  
de.hybris.platform.acceleratorstorefrontcommons.forms.payment.impl  
de.hybris.platform.acceleratorstorefrontcommons.forms.validation  
de.hybris.platform.acceleratorstorefrontcommons.forms.verification  
de.hybris.platform.acceleratorstorefrontcommons.forms.verification.impl  
de.hybris.platform.acceleratorstorefrontcommons.history  
de.hybris.platform.acceleratorstorefrontcommons.history.impl  
de.hybris.platform.acceleratorstorefrontcommons.interceptors  
de.hybris.platform.acceleratorstorefrontcommons.jalo  
de.hybris.platform.acceleratorstorefrontcommons.security  
de.hybris.platform.acceleratorstorefrontcommons.security.impl  
de.hybris.platform.acceleratorstorefrontcommons.strategy  
de.hybris.platform.acceleratorstorefrontcommons.strategy.impl  
de.hybris.platform.acceleratorstorefrontcommons.tags  
de.hybris.platform.acceleratorstorefrontcommons.util  
de.hybris.platform.acceleratorstorefrontcommons.variants  
de.hybris.platform.acceleratorstorefrontcommons.variants.impl  
de.hybris.platform.acceleratorwebservicesaddon.constants  
de.hybris.platform.acceleratorwebservicesaddon.controllers  
de.hybris.platform.acceleratorwebservicesaddon.controllers.v2  
de.hybris.platform.acceleratorwebservicesaddon.cronjob  
de.hybris.platform.acceleratorwebservicesaddon.dto.payment  
de.hybris.platform.acceleratorwebservicesaddon.exceptions  
de.hybris.platform.acceleratorwebservicesaddon.jalo  
de.hybris.platform.acceleratorwebservicesaddon.order.hook  
de.hybris.platform.acceleratorwebservicesaddon.payment.dao  
de.hybris.platform.acceleratorwebservicesaddon.payment.dao.impl  
de.hybris.platform.acceleratorwebservicesaddon.payment.facade  
de.hybris.platform.acceleratorwebservicesaddon.payment.facade.impl  
de.hybris.platform.acceleratorwebservicesaddon.payment.populators.impl  
de.hybris.platform.acceleratorwebservicesaddon.payment.service  
de.hybris.platform.acceleratorwebservicesaddon.payment.service.impl  
de.hybris.platform.acceleratorwebservicesaddon.populators.impl  
de.hybris.platform.acceleratorwebservicesaddon.urlresolver.impl  
de.hybris.platform.acceleratorwebservicesaddon.validator  
de.hybris.platform.accountsummaryaddon  
de.hybris.platform.accountsummaryaddon.attributehandlers  
de.hybris.platform.accountsummaryaddon.breadcrumb.impl  
de.hybris.platform.accountsummaryaddon.constants  
de.hybris.platform.accountsummaryaddon.controllers  
de.hybris.platform.accountsummaryaddon.controllers.pages  
de.hybris.platform.accountsummaryaddon.converters.populators  
de.hybris.platform.accountsummaryaddon.cronjob  
de.hybris.platform.accountsummaryaddon.data  
de.hybris.platform.accountsummaryaddon.document  
de.hybris.platform.accountsummaryaddon.document.criteria  
de.hybris.platform.accountsummaryaddon.document.criteria.validator  
de.hybris.platform.accountsummaryaddon.document.criteria.validator.impl  
de.hybris.platform.accountsummaryaddon.document.dao  
de.hybris.platform.accountsummaryaddon.document.dao.impl  
de.hybris.platform.accountsummaryaddon.document.data  
de.hybris.platform.accountsummaryaddon.document.populators  
de.hybris.platform.accountsummaryaddon.document.service  
de.hybris.platform.accountsummaryaddon.document.service.impl  
de.hybris.platform.accountsummaryaddon.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.accountsummaryaddon.facade  
de.hybris.platform.accountsummaryaddon.facade.impl  
de.hybris.platform.accountsummaryaddon.formatters  
de.hybris.platform.accountsummaryaddon.formatters.impl  
de.hybris.platform.accountsummaryaddon.interceptor  
de.hybris.platform.accountsummaryaddon.interceptors  
de.hybris.platform.accountsummaryaddon.jalo  
de.hybris.platform.accountsummaryaddon.model
Contains generated models for each type of de.hybris.platform.accountsummaryaddon.jalo package.
de.hybris.platform.accountsummaryaddon.model.cronjob
Contains generated models for each type of de.hybris.platform.accountsummaryaddon.cronjob package.
de.hybris.platform.accountsummaryaddon.populators  
de.hybris.platform.accountsummaryaddon.utils  
de.hybris.platform.adaptivesearch  
de.hybris.platform.adaptivesearch.constants  
de.hybris.platform.adaptivesearch.context  
de.hybris.platform.adaptivesearch.context.impl  
de.hybris.platform.adaptivesearch.converters  
de.hybris.platform.adaptivesearch.converters.populators  
de.hybris.platform.adaptivesearch.daos  
de.hybris.platform.adaptivesearch.daos.impl  
de.hybris.platform.adaptivesearch.data  
de.hybris.platform.adaptivesearch.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.adaptivesearch.integration  
de.hybris.platform.adaptivesearch.integration.model  
de.hybris.platform.adaptivesearch.integration.synchronization  
de.hybris.platform.adaptivesearch.jalo  
de.hybris.platform.adaptivesearch.model
Contains generated models for each type of de.hybris.platform.adaptivesearch.jalo package.
de.hybris.platform.adaptivesearch.model.attributes  
de.hybris.platform.adaptivesearch.model.interceptors  
de.hybris.platform.adaptivesearch.searchservices.listeners  
de.hybris.platform.adaptivesearch.searchservices.strategies  
de.hybris.platform.adaptivesearch.searchservices.strategies.impl  
de.hybris.platform.adaptivesearch.services  
de.hybris.platform.adaptivesearch.services.impl  
de.hybris.platform.adaptivesearch.setup  
de.hybris.platform.adaptivesearch.strategies  
de.hybris.platform.adaptivesearch.strategies.impl  
de.hybris.platform.adaptivesearch.util  
de.hybris.platform.adaptivesearch.util.impl  
de.hybris.platform.adaptivesearchbackoffice.actions.boostitems  
de.hybris.platform.adaptivesearchbackoffice.actions.configurablemultireferenceeditor  
de.hybris.platform.adaptivesearchbackoffice.actions.configurablemultireferenceeditor.deleteoverridereference  
de.hybris.platform.adaptivesearchbackoffice.actions.configurablemultireferenceeditor.deletereference  
de.hybris.platform.adaptivesearchbackoffice.actions.configurablemultireferenceeditor.editreference  
de.hybris.platform.adaptivesearchbackoffice.actions.deletesearchconfiguration  
de.hybris.platform.adaptivesearchbackoffice.actions.facets  
de.hybris.platform.adaptivesearchbackoffice.actions.results  
de.hybris.platform.adaptivesearchbackoffice.actions.results.discardoverridepromoteditem  
de.hybris.platform.adaptivesearchbackoffice.actions.results.excludeitem  
de.hybris.platform.adaptivesearchbackoffice.actions.results.overridepromoteditem  
de.hybris.platform.adaptivesearchbackoffice.actions.results.promoteitem  
de.hybris.platform.adaptivesearchbackoffice.actions.results.rankitemdown  
de.hybris.platform.adaptivesearchbackoffice.actions.results.rankitemfirst  
de.hybris.platform.adaptivesearchbackoffice.actions.results.rankitemlast  
de.hybris.platform.adaptivesearchbackoffice.actions.results.rankitemup  
de.hybris.platform.adaptivesearchbackoffice.actions.results.unpromoteitem  
de.hybris.platform.adaptivesearchbackoffice.actions.sorts  
de.hybris.platform.adaptivesearchbackoffice.common  
de.hybris.platform.adaptivesearchbackoffice.common.impl  
de.hybris.platform.adaptivesearchbackoffice.components  
de.hybris.platform.adaptivesearchbackoffice.constants  
de.hybris.platform.adaptivesearchbackoffice.data  
de.hybris.platform.adaptivesearchbackoffice.editors  
de.hybris.platform.adaptivesearchbackoffice.editors.boostitemreference  
de.hybris.platform.adaptivesearchbackoffice.editors.boostrules  
de.hybris.platform.adaptivesearchbackoffice.editors.boostrulevalue  
de.hybris.platform.adaptivesearchbackoffice.editors.configurabledropdown  
de.hybris.platform.adaptivesearchbackoffice.editors.configurableintegereditor  
de.hybris.platform.adaptivesearchbackoffice.editors.configurablemultireference  
de.hybris.platform.adaptivesearchbackoffice.editors.excludedfacets  
de.hybris.platform.adaptivesearchbackoffice.editors.excludeditems  
de.hybris.platform.adaptivesearchbackoffice.editors.excludedsorts  
de.hybris.platform.adaptivesearchbackoffice.editors.extendedconfigurabledropdown  
de.hybris.platform.adaptivesearchbackoffice.editors.facetrangeboundaryvalue  
de.hybris.platform.adaptivesearchbackoffice.editors.facets  
de.hybris.platform.adaptivesearchbackoffice.editors.promotedfacets  
de.hybris.platform.adaptivesearchbackoffice.editors.promoteditems  
de.hybris.platform.adaptivesearchbackoffice.editors.promotedsorts  
de.hybris.platform.adaptivesearchbackoffice.editors.sorts  
de.hybris.platform.adaptivesearchbackoffice.facades  
de.hybris.platform.adaptivesearchbackoffice.facades.impl  
de.hybris.platform.adaptivesearchbackoffice.strategies  
de.hybris.platform.adaptivesearchbackoffice.widgets  
de.hybris.platform.adaptivesearchbackoffice.widgets.categoryselector  
de.hybris.platform.adaptivesearchbackoffice.widgets.maincontroller  
de.hybris.platform.adaptivesearchbackoffice.widgets.navigationcontext  
de.hybris.platform.adaptivesearchbackoffice.widgets.searchconfigurationadapter  
de.hybris.platform.adaptivesearchbackoffice.widgets.searchcontext  
de.hybris.platform.adaptivesearchbackoffice.widgets.searchprofilecontext  
de.hybris.platform.adaptivesearchbackoffice.widgets.searchresultbrowser  
de.hybris.platform.adaptivesearchfacades.constants  
de.hybris.platform.adaptivesearchfacades.converters.populators  
de.hybris.platform.adaptivesearchfacades.facades  
de.hybris.platform.adaptivesearchfacades.facades.impl  
de.hybris.platform.adaptivesearchsamplesaddon.constants  
de.hybris.platform.adaptivesearchsolr.constants  
de.hybris.platform.adaptivesearchsolr.integration  
de.hybris.platform.adaptivesearchsolr.listeners  
de.hybris.platform.adaptivesearchsolr.strategies  
de.hybris.platform.adaptivesearchsolr.strategies.impl  
de.hybris.platform.adaptivesearchwebservices.config  
de.hybris.platform.adaptivesearchwebservices.constants  
de.hybris.platform.adaptivesearchwebservices.controllers  
de.hybris.platform.addons.xyformssamples.constants  
de.hybris.platform.addons.xyformssamples.controllers  
de.hybris.platform.addons.xyformssamples.controllers.pages  
de.hybris.platform.addons.xyformssamples.jalo  
de.hybris.platform.addonsupport.config  
de.hybris.platform.addonsupport.config.bundlesources  
de.hybris.platform.addonsupport.config.cms.dataattributeproviders  
de.hybris.platform.addonsupport.config.javascript  
de.hybris.platform.addonsupport.constants  
de.hybris.platform.addonsupport.controllers  
de.hybris.platform.addonsupport.controllers.cms  
de.hybris.platform.addonsupport.controllers.page  
de.hybris.platform.addonsupport.data  
de.hybris.platform.addonsupport.impex  
de.hybris.platform.addonsupport.interceptors  
de.hybris.platform.addonsupport.jalo  
de.hybris.platform.addonsupport.renderer.impl  
de.hybris.platform.addonsupport.setup  
de.hybris.platform.addonsupport.setup.events  
de.hybris.platform.addonsupport.setup.impl  
de.hybris.platform.addonsupport.setup.populator  
de.hybris.platform.addonsupport.valueprovider  
de.hybris.platform.addonsupport.valueprovider.impl  
de.hybris.platform.addressaddon.constants  
de.hybris.platform.addressaddon.controllers  
de.hybris.platform.addressaddon.controllers.imported  
de.hybris.platform.addressaddon.controllers.misc  
de.hybris.platform.addressaddon.controllers.pages  
de.hybris.platform.addressaddon.controllers.pages.checkout.steps  
de.hybris.platform.addressaddon.controllers.pages.checkout.steps.imported  
de.hybris.platform.addressaddon.controllers.pages.imported  
de.hybris.platform.addressaddon.forms  
de.hybris.platform.addressaddon.forms.validation  
de.hybris.platform.addressaddon.handlers  
de.hybris.platform.addressaddon.jalo  
de.hybris.platform.addressaddon.model
Contains generated models for each type of de.hybris.platform.addressaddon.jalo package.
de.hybris.platform.addressfacades.address  
de.hybris.platform.addressfacades.address.impl  
de.hybris.platform.addressfacades.constants  
de.hybris.platform.addressfacades.data  
de.hybris.platform.addressfacades.jalo  
de.hybris.platform.addressfacades.populators  
de.hybris.platform.addressservices.address  
de.hybris.platform.addressservices.address.daos  
de.hybris.platform.addressservices.address.daos.impl  
de.hybris.platform.addressservices.address.impl  
de.hybris.platform.addressservices.constants  
de.hybris.platform.addressservices.interceptors  
de.hybris.platform.addressservices.jalo  
de.hybris.platform.addressservices.model
Contains generated models for each type of de.hybris.platform.addressservices.jalo package.
de.hybris.platform.addressservices.strategies  
de.hybris.platform.addressservices.strategies.impl  
de.hybris.platform.adminapi.annotation  
de.hybris.platform.adminapi.components.common  
de.hybris.platform.adminapi.components.config  
de.hybris.platform.adminapi.components.console.search  
de.hybris.platform.adminapi.components.initializer  
de.hybris.platform.adminapi.components.util  
de.hybris.platform.adminapi.constants  
de.hybris.platform.adminapi.converters  
de.hybris.platform.adminapi.exceptions  
de.hybris.platform.adminapi.jalo  
de.hybris.platform.admincockpit.buttons  
de.hybris.platform.admincockpit.components.editorarea  
de.hybris.platform.admincockpit.components.listview.impl  
de.hybris.platform.admincockpit.components.navigationarea  
de.hybris.platform.admincockpit.components.navigationarea.renderer  
de.hybris.platform.admincockpit.constants  
de.hybris.platform.admincockpit.jalo  
de.hybris.platform.admincockpit.jalo.cronjob  
de.hybris.platform.admincockpit.model.cronjob
Contains generated models for each type of de.hybris.platform.admincockpit.jalo.cronjob package.
de.hybris.platform.admincockpit.model.listview.impl  
de.hybris.platform.admincockpit.model.referenceeditor.impl  
de.hybris.platform.admincockpit.services  
de.hybris.platform.admincockpit.services.config.impl  
de.hybris.platform.admincockpit.services.impl  
de.hybris.platform.admincockpit.services.label.impl  
de.hybris.platform.admincockpit.session.impl  
de.hybris.platform.admincockpit.util  
de.hybris.platform.admincockpit.wizards  
de.hybris.platform.advancedsavedquery.constants  
de.hybris.platform.advancedsavedquery.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.advancedsavedquery.jalo  
de.hybris.platform.advancedsavedquery.model
Contains generated models for each type of de.hybris.platform.advancedsavedquery.jalo package.
de.hybris.platform.advancedsavedquery.systemsetup  
de.hybris.platform.amazon.constants  
de.hybris.platform.amazon.jalo  
de.hybris.platform.amazon.media.services  
de.hybris.platform.amazon.media.services.impl  
de.hybris.platform.amazon.media.storage  
de.hybris.platform.amazon.media.url  
de.hybris.platform.aop  
de.hybris.platform.apiregistrybackoffice.actions  
de.hybris.platform.apiregistrybackoffice.constants  
de.hybris.platform.apiregistrybackoffice.data  
de.hybris.platform.apiregistrybackoffice.handlers  
de.hybris.platform.apiregistrybackoffice.widgets  
de.hybris.platform.apiregistryservices  
de.hybris.platform.apiregistryservices.action  
de.hybris.platform.apiregistryservices.constants  
de.hybris.platform.apiregistryservices.constraints  
de.hybris.platform.apiregistryservices.dao  
de.hybris.platform.apiregistryservices.dao.impl  
de.hybris.platform.apiregistryservices.dto  
de.hybris.platform.apiregistryservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.apiregistryservices.event  
de.hybris.platform.apiregistryservices.event.impl  
de.hybris.platform.apiregistryservices.event.listeners  
de.hybris.platform.apiregistryservices.events  
de.hybris.platform.apiregistryservices.exceptions  
de.hybris.platform.apiregistryservices.factory  
de.hybris.platform.apiregistryservices.factory.client  
de.hybris.platform.apiregistryservices.factory.impl  
de.hybris.platform.apiregistryservices.interceptors  
de.hybris.platform.apiregistryservices.jalo  
de.hybris.platform.apiregistryservices.jalo.constraints  
de.hybris.platform.apiregistryservices.jalo.events  
de.hybris.platform.apiregistryservices.jmx  
de.hybris.platform.apiregistryservices.jmx.service  
de.hybris.platform.apiregistryservices.jmx.service.impl  
de.hybris.platform.apiregistryservices.model
Contains generated models for each type of de.hybris.platform.apiregistryservices.jalo package.
de.hybris.platform.apiregistryservices.model.constraints
Contains generated models for each type of de.hybris.platform.apiregistryservices.jalo.constraints package.
de.hybris.platform.apiregistryservices.model.events
Contains generated models for each type of de.hybris.platform.apiregistryservices.jalo.events package.
de.hybris.platform.apiregistryservices.populators  
de.hybris.platform.apiregistryservices.router  
de.hybris.platform.apiregistryservices.services  
de.hybris.platform.apiregistryservices.services.impl  
de.hybris.platform.apiregistryservices.strategies  
de.hybris.platform.apiregistryservices.strategies.impl  
de.hybris.platform.apiregistryservices.task  
de.hybris.platform.apiregistryservices.utils  
de.hybris.platform.apparelstore.constants  
de.hybris.platform.apparelstore.jalo  
de.hybris.platform.apparelstore.setup  
de.hybris.platform.assertions  
de.hybris.platform.assistedservicecustomerinterestsaddon.constants  
de.hybris.platform.assistedservicecustomerinterestsaddon.controllers  
de.hybris.platform.assistedservicecustomerinterestsaddon.jalo  
de.hybris.platform.assistedservicecustomerinterestsfacades.constants  
de.hybris.platform.assistedservicecustomerinterestsfacades.customer360.provider  
de.hybris.platform.assistedservicecustomerinterestsfacades.jalo  
de.hybris.platform.assistedservicefacades  
de.hybris.platform.assistedservicefacades.constants  
de.hybris.platform.assistedservicefacades.customer.converters.populator  
de.hybris.platform.assistedservicefacades.customer360  
de.hybris.platform.assistedservicefacades.customer360.comparators  
de.hybris.platform.assistedservicefacades.customer360.exception  
de.hybris.platform.assistedservicefacades.customer360.impl  
de.hybris.platform.assistedservicefacades.event  
de.hybris.platform.assistedservicefacades.hook  
de.hybris.platform.assistedservicefacades.impl  
de.hybris.platform.assistedservicefacades.jalo  
de.hybris.platform.assistedservicefacades.populator  
de.hybris.platform.assistedservicefacades.user.data  
de.hybris.platform.assistedservicefacades.util  
de.hybris.platform.assistedservicepromotionaddon.constants  
de.hybris.platform.assistedservicepromotionaddon.controllers  
de.hybris.platform.assistedservicepromotionaddon.jalo  
de.hybris.platform.assistedservicepromotionfacades  
de.hybris.platform.assistedservicepromotionfacades.constants  
de.hybris.platform.assistedservicepromotionfacades.customer360  
de.hybris.platform.assistedservicepromotionfacades.data.provider  
de.hybris.platform.assistedservicepromotionfacades.impl  
de.hybris.platform.assistedservicepromotionfacades.jalo  
de.hybris.platform.assistedservicepromotionfacades.populator  
de.hybris.platform.assistedserviceservices  
de.hybris.platform.assistedserviceservices.constants  
de.hybris.platform.assistedserviceservices.dao  
de.hybris.platform.assistedserviceservices.dao.impl  
de.hybris.platform.assistedserviceservices.events  
de.hybris.platform.assistedserviceservices.events.impl  
de.hybris.platform.assistedserviceservices.exception  
de.hybris.platform.assistedserviceservices.impl  
de.hybris.platform.assistedserviceservices.jalo  
de.hybris.platform.assistedserviceservices.strategy  
de.hybris.platform.assistedserviceservices.utils  
de.hybris.platform.assistedservicestorefront.aspect  
de.hybris.platform.assistedservicestorefront.component.renderer  
de.hybris.platform.assistedservicestorefront.constants  
de.hybris.platform.assistedservicestorefront.controllers  
de.hybris.platform.assistedservicestorefront.controllers.cms  
de.hybris.platform.assistedservicestorefront.customer360  
de.hybris.platform.assistedservicestorefront.customer360.populator  
de.hybris.platform.assistedservicestorefront.customer360.populators  
de.hybris.platform.assistedservicestorefront.customer360.provider  
de.hybris.platform.assistedservicestorefront.filter  
de.hybris.platform.assistedservicestorefront.jalo  
de.hybris.platform.assistedservicestorefront.model
Contains generated models for each type of de.hybris.platform.assistedservicestorefront.jalo package.
de.hybris.platform.assistedservicestorefront.redirect  
de.hybris.platform.assistedservicestorefront.redirect.impl  
de.hybris.platform.assistedservicestorefront.restrictions  
de.hybris.platform.assistedservicestorefront.security  
de.hybris.platform.assistedservicestorefront.security.impl  
de.hybris.platform.assistedservicestorefront.util  
de.hybris.platform.assistedservicestorefront.valueprovider  
de.hybris.platform.assistedservicewebservices.config  
de.hybris.platform.assistedservicewebservices.constants  
de.hybris.platform.assistedservicewebservices.controllers  
de.hybris.platform.assistedservicewebservices.dto  
de.hybris.platform.assistedservicewebservices.filters  
de.hybris.platform.assistedservicewebservices.helper  
de.hybris.platform.assistedservicewebservices.jalo  
de.hybris.platform.assistedservicewebservices.swagger  
de.hybris.platform.assistedservicewebservices.utils  
de.hybris.platform.assistedserviceyprofileaddon.constants  
de.hybris.platform.assistedserviceyprofileaddon.controllers  
de.hybris.platform.assistedserviceyprofileaddon.jalo  
de.hybris.platform.assistedserviceyprofilefacades  
de.hybris.platform.assistedserviceyprofilefacades.constants  
de.hybris.platform.assistedserviceyprofilefacades.data  
de.hybris.platform.assistedserviceyprofilefacades.data.provider  
de.hybris.platform.assistedserviceyprofilefacades.impl  
de.hybris.platform.assistedserviceyprofilefacades.jalo  
de.hybris.platform.assistedserviceyprofilefacades.populator  
de.hybris.platform.audit  
de.hybris.platform.audit.demo  
de.hybris.platform.audit.internal  
de.hybris.platform.audit.internal.conditional  
de.hybris.platform.audit.internal.config  
de.hybris.platform.audit.internal.config.validation  
de.hybris.platform.audit.internal.interceptors  
de.hybris.platform.audit.provider  
de.hybris.platform.audit.provider.impl  
de.hybris.platform.audit.provider.internal.resolver  
de.hybris.platform.audit.provider.internal.resolver.impl  
de.hybris.platform.audit.view  
de.hybris.platform.audit.view.impl  
de.hybris.platform.auditreport.constants  
de.hybris.platform.auditreport.jalo  
de.hybris.platform.auditreport.model
Contains generated models for each type of de.hybris.platform.auditreport.jalo package.
de.hybris.platform.auditreport.retention.impl  
de.hybris.platform.auditreport.service  
de.hybris.platform.auditreport.service.impl  
de.hybris.platform.auditreport.service.impl.io  
de.hybris.platform.auditreport.service.impl.velocity  
de.hybris.platform.azure  
de.hybris.platform.azure.constants  
de.hybris.platform.azure.jalo  
de.hybris.platform.azure.media  
de.hybris.platform.azure.media.storage  
de.hybris.platform.azure.media.url  
de.hybris.platform.b2b  
de.hybris.platform.b2b.attributes  
de.hybris.platform.b2b.company  
de.hybris.platform.b2b.company.impl  
de.hybris.platform.b2b.constants  
de.hybris.platform.b2b.dao  
de.hybris.platform.b2b.dao.impl  
de.hybris.platform.b2b.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.b2b.event  
de.hybris.platform.b2b.interceptor  
de.hybris.platform.b2b.jalo  
de.hybris.platform.b2b.listeners  
de.hybris.platform.b2b.mail  
de.hybris.platform.b2b.mail.impl  
de.hybris.platform.b2b.migration  
de.hybris.platform.b2b.mock  
de.hybris.platform.b2b.model
Contains generated models for each type of de.hybris.platform.b2b.jalo package.
de.hybris.platform.b2b.occ  
de.hybris.platform.b2b.occ.constants  
de.hybris.platform.b2b.occ.exceptions  
de.hybris.platform.b2b.occ.jalo  
de.hybris.platform.b2b.occ.mapping.converter  
de.hybris.platform.b2b.occ.mapping.mappers  
de.hybris.platform.b2b.occ.populators  
de.hybris.platform.b2b.occ.security  
de.hybris.platform.b2b.occ.strategy  
de.hybris.platform.b2b.occ.strategy.impl  
de.hybris.platform.b2b.occ.util  
de.hybris.platform.b2b.occ.v2.controllers  
de.hybris.platform.b2b.occ.v2.helper  
de.hybris.platform.b2b.occ.validators  
de.hybris.platform.b2b.order  
de.hybris.platform.b2b.order.hooks  
de.hybris.platform.b2b.order.impl  
de.hybris.platform.b2b.process.approval.actions  
de.hybris.platform.b2b.process.approval.event  
de.hybris.platform.b2b.process.approval.jalo  
de.hybris.platform.b2b.process.approval.model
Contains generated models for each type of de.hybris.platform.b2b.process.approval.jalo package.
de.hybris.platform.b2b.process.approval.services  
de.hybris.platform.b2b.process.approval.services.impl  
de.hybris.platform.b2b.punchout  
de.hybris.platform.b2b.punchout.actions  
de.hybris.platform.b2b.punchout.constants  
de.hybris.platform.b2b.punchout.daos  
de.hybris.platform.b2b.punchout.daos.impl  
de.hybris.platform.b2b.punchout.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.b2b.punchout.interceptor  
de.hybris.platform.b2b.punchout.jalo  
de.hybris.platform.b2b.punchout.model
Contains generated models for each type of de.hybris.platform.b2b.punchout.jalo package.
de.hybris.platform.b2b.punchout.order  
de.hybris.platform.b2b.punchout.populators.impl  
de.hybris.platform.b2b.punchout.services  
de.hybris.platform.b2b.punchout.services.impl  
de.hybris.platform.b2b.punchout.util  
de.hybris.platform.b2b.services  
de.hybris.platform.b2b.services.impl  
de.hybris.platform.b2b.strategies  
de.hybris.platform.b2b.strategies.impl  
de.hybris.platform.b2b.testframework  
de.hybris.platform.b2b.util  
de.hybris.platform.b2b.util.impl  
de.hybris.platform.b2bacceleratoraddon  
de.hybris.platform.b2bacceleratoraddon.actions  
de.hybris.platform.b2bacceleratoraddon.actions.replenishment  
de.hybris.platform.b2bacceleratoraddon.base  
de.hybris.platform.b2bacceleratoraddon.checkout.steps  
de.hybris.platform.b2bacceleratoraddon.checkout.steps.validation  
de.hybris.platform.b2bacceleratoraddon.checkout.steps.validation.impl  
de.hybris.platform.b2bacceleratoraddon.component.renderer  
de.hybris.platform.b2bacceleratoraddon.constants  
de.hybris.platform.b2bacceleratoraddon.controllers  
de.hybris.platform.b2bacceleratoraddon.controllers.pages  
de.hybris.platform.b2bacceleratoraddon.controllers.pages.checkout  
de.hybris.platform.b2bacceleratoraddon.controllers.pages.checkout.steps  
de.hybris.platform.b2bacceleratoraddon.event  
de.hybris.platform.b2bacceleratoraddon.forms  
de.hybris.platform.b2bacceleratoraddon.forms.validation  
de.hybris.platform.b2bacceleratoraddon.interceptors  
de.hybris.platform.b2bacceleratoraddon.jalo  
de.hybris.platform.b2bacceleratoraddon.jalo.actions  
de.hybris.platform.b2bacceleratoraddon.model.actions
Contains generated models for each type of de.hybris.platform.b2bacceleratoraddon.jalo.actions package.
de.hybris.platform.b2bacceleratoraddon.order.impl  
de.hybris.platform.b2bacceleratoraddon.proccess.email.context  
de.hybris.platform.b2bacceleratoraddon.security  
de.hybris.platform.b2bacceleratoraddon.security.impl  
de.hybris.platform.b2bacceleratorfacades.api.cart  
de.hybris.platform.b2bacceleratorfacades.api.company  
de.hybris.platform.b2bacceleratorfacades.api.search  
de.hybris.platform.b2bacceleratorfacades.checkout.data  
de.hybris.platform.b2bacceleratorfacades.company  
de.hybris.platform.b2bacceleratorfacades.company.data  
de.hybris.platform.b2bacceleratorfacades.company.impl  
de.hybris.platform.b2bacceleratorfacades.company.populators  
de.hybris.platform.b2bacceleratorfacades.company.refactoring.impl  
de.hybris.platform.b2bacceleratorfacades.constants  
de.hybris.platform.b2bacceleratorfacades.customer.exception  
de.hybris.platform.b2bacceleratorfacades.customer.impl  
de.hybris.platform.b2bacceleratorfacades.exception  
de.hybris.platform.b2bacceleratorfacades.futurestock  
de.hybris.platform.b2bacceleratorfacades.futurestock.impl  
de.hybris.platform.b2bacceleratorfacades.order  
de.hybris.platform.b2bacceleratorfacades.order.converters.populator  
de.hybris.platform.b2bacceleratorfacades.order.data  
de.hybris.platform.b2bacceleratorfacades.order.impl  
de.hybris.platform.b2bacceleratorfacades.order.populators  
de.hybris.platform.b2bacceleratorfacades.process.email.context  
de.hybris.platform.b2bacceleratorfacades.product.data  
de.hybris.platform.b2bacceleratorfacades.query  
de.hybris.platform.b2bacceleratorfacades.search.converters.impl  
de.hybris.platform.b2bacceleratorfacades.search.data  
de.hybris.platform.b2bacceleratorfacades.search.impl  
de.hybris.platform.b2bacceleratorfacades.user.populators  
de.hybris.platform.b2bacceleratorservices.company  
de.hybris.platform.b2bacceleratorservices.company.impl  
de.hybris.platform.b2bacceleratorservices.constants  
de.hybris.platform.b2bacceleratorservices.customer  
de.hybris.platform.b2bacceleratorservices.customer.impl  
de.hybris.platform.b2bacceleratorservices.dao  
de.hybris.platform.b2bacceleratorservices.dao.impl  
de.hybris.platform.b2bacceleratorservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.b2bacceleratorservices.event  
de.hybris.platform.b2bacceleratorservices.futurestock.impl  
de.hybris.platform.b2bacceleratorservices.jalo  
de.hybris.platform.b2bacceleratorservices.jalo.process  
de.hybris.platform.b2bacceleratorservices.jalo.promotions  
de.hybris.platform.b2bacceleratorservices.model.process
Contains generated models for each type of de.hybris.platform.b2bacceleratorservices.jalo.process package.
de.hybris.platform.b2bacceleratorservices.model.promotions
Contains generated models for each type of de.hybris.platform.b2bacceleratorservices.jalo.promotions package.
de.hybris.platform.b2bacceleratorservices.order  
de.hybris.platform.b2bacceleratorservices.order.checkout.flow  
de.hybris.platform.b2bacceleratorservices.order.checkout.flow.impl  
de.hybris.platform.b2bacceleratorservices.order.checkout.pci  
de.hybris.platform.b2bacceleratorservices.order.checkout.pci.impl  
de.hybris.platform.b2bacceleratorservices.order.impl  
de.hybris.platform.b2bacceleratorservices.orderscheduling.impl  
de.hybris.platform.b2bacceleratorservices.process.strategies.impl  
de.hybris.platform.b2bacceleratorservices.product  
de.hybris.platform.b2bacceleratorservices.product.impl  
de.hybris.platform.b2bacceleratorservices.search  
de.hybris.platform.b2bacceleratorservices.search.impl  
de.hybris.platform.b2bacceleratorservices.strategies  
de.hybris.platform.b2bacceleratorservices.strategies.impl  
de.hybris.platform.b2bapprovalprocessfacades  
de.hybris.platform.b2bapprovalprocessfacades.company  
de.hybris.platform.b2bapprovalprocessfacades.company.converters.populators  
de.hybris.platform.b2bapprovalprocessfacades.company.data  
de.hybris.platform.b2bapprovalprocessfacades.company.impl  
de.hybris.platform.b2bapprovalprocessfacades.constants  
de.hybris.platform.b2bapprovalprocessfacades.jalo  
de.hybris.platform.b2bapprovalprocessfacades.util  
de.hybris.platform.b2bcommerce.backoffice  
de.hybris.platform.b2bcommerce.backoffice.actions  
de.hybris.platform.b2bcommerce.backoffice.constants  
de.hybris.platform.b2bcommerce.backoffice.editor  
de.hybris.platform.b2bcommerce.backoffice.jalo  
de.hybris.platform.b2bcommercefacades  
de.hybris.platform.b2bcommercefacades.company  
de.hybris.platform.b2bcommercefacades.company.converters.populators  
de.hybris.platform.b2bcommercefacades.company.data  
de.hybris.platform.b2bcommercefacades.company.impl  
de.hybris.platform.b2bcommercefacades.company.util  
de.hybris.platform.b2bcommercefacades.constants  
de.hybris.platform.b2bcommercefacades.jalo  
de.hybris.platform.b2bcommercefacades.order  
de.hybris.platform.b2bcommercefacades.order.impl  
de.hybris.platform.b2bcommercefacades.search  
de.hybris.platform.b2bcommercefacades.search.data  
de.hybris.platform.b2bcommercefacades.testframework  
de.hybris.platform.b2bcommercefacades.util  
de.hybris.platform.b2bdocumentsfilter  
de.hybris.platform.b2bocc  
de.hybris.platform.b2bocc.constants  
de.hybris.platform.b2bocc.exceptions  
de.hybris.platform.b2bocc.jalo  
de.hybris.platform.b2bocc.mapping.converter  
de.hybris.platform.b2bocc.mapping.mappers  
de.hybris.platform.b2bocc.populators  
de.hybris.platform.b2bocc.security  
de.hybris.platform.b2bocc.strategy  
de.hybris.platform.b2bocc.strategy.impl  
de.hybris.platform.b2bocc.util  
de.hybris.platform.b2bocc.v2.controllers  
de.hybris.platform.b2bocc.v2.helper  
de.hybris.platform.b2bocc.validators  
de.hybris.platform.b2bocctests  
de.hybris.platform.b2bocctests.constants  
de.hybris.platform.b2bocctests.jalo  
de.hybris.platform.b2bocctests.setup  
de.hybris.platform.b2bordermanagementfacades  
de.hybris.platform.b2bordermanagementfacades.constants  
de.hybris.platform.b2bordermanagementfacades.jalo  
de.hybris.platform.b2bordermanagementfacades.order.converters.populator  
de.hybris.platform.b2bordermanagementfacades.order.impl  
de.hybris.platform.b2bordermanagementwebservices  
de.hybris.platform.b2bordermanagementwebservices.constants  
de.hybris.platform.b2bordermanagementwebservices.jalo  
de.hybris.platform.b2bpunchoutaddon  
de.hybris.platform.b2bpunchoutaddon.constants  
de.hybris.platform.b2bpunchoutaddon.controllers  
de.hybris.platform.b2bpunchoutaddon.controllers.pages  
de.hybris.platform.b2bpunchoutaddon.converter  
de.hybris.platform.b2bpunchoutaddon.interceptors  
de.hybris.platform.b2bpunchoutaddon.jalo  
de.hybris.platform.b2bpunchoutaddon.security  
de.hybris.platform.b2bpunchoutaddon.security.impl  
de.hybris.platform.b2bpunchoutaddon.services  
de.hybris.platform.b2bpunchoutaddon.services.impl  
de.hybris.platform.b2bwebservicescommons.constants  
de.hybris.platform.b2bwebservicescommons.dto.company  
de.hybris.platform.b2bwebservicescommons.dto.mycompany  
de.hybris.platform.b2bwebservicescommons.dto.order  
de.hybris.platform.b2bwebservicescommons.jalo  
de.hybris.platform.basecommerce.backoffice  
de.hybris.platform.basecommerce.backoffice.constants  
de.hybris.platform.basecommerce.backoffice.editor  
de.hybris.platform.basecommerce.backoffice.jalo  
de.hybris.platform.basecommerce.constants  
de.hybris.platform.basecommerce.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.basecommerce.exceptions  
de.hybris.platform.basecommerce.jalo  
de.hybris.platform.basecommerce.jalo.externaltax  
de.hybris.platform.basecommerce.jalo.site  
de.hybris.platform.basecommerce.messages  
de.hybris.platform.basecommerce.messages.impl  
de.hybris.platform.basecommerce.model
Contains generated models for each type of de.hybris.platform.basecommerce.jalo package.
de.hybris.platform.basecommerce.model.externaltax
Contains generated models for each type of de.hybris.platform.basecommerce.jalo.externaltax package.
de.hybris.platform.basecommerce.model.site
Contains generated models for each type of de.hybris.platform.basecommerce.jalo.site package.
de.hybris.platform.basecommerce.site.dao  
de.hybris.platform.basecommerce.site.dao.impl  
de.hybris.platform.basecommerce.strategies  
de.hybris.platform.basecommerce.strategies.impl  
de.hybris.platform.basecommerce.util  
de.hybris.platform.cache  
de.hybris.platform.cache.impl  
de.hybris.platform.cache.udp  
de.hybris.platform.cache2  
de.hybris.platform.campaigns.dao  
de.hybris.platform.campaigns.dao.impl  
de.hybris.platform.campaigns.jalo  
de.hybris.platform.campaigns.model
Contains generated models for each type of de.hybris.platform.campaigns.jalo package.
de.hybris.platform.campaigns.service  
de.hybris.platform.campaigns.service.impl  
de.hybris.platform.catalog  
de.hybris.platform.catalog.constants  
de.hybris.platform.catalog.daos  
de.hybris.platform.catalog.daos.impl  
de.hybris.platform.catalog.data  
de.hybris.platform.catalog.dynamic  
de.hybris.platform.catalog.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.catalog.exceptions  
de.hybris.platform.catalog.impl  
de.hybris.platform.catalog.interceptors  
de.hybris.platform.catalog.jalo  
de.hybris.platform.catalog.jalo.classification  
de.hybris.platform.catalog.jalo.classification.eclass  
de.hybris.platform.catalog.jalo.classification.etim  
de.hybris.platform.catalog.jalo.classification.impex  
de.hybris.platform.catalog.jalo.classification.proficlass  
de.hybris.platform.catalog.jalo.classification.unspsc  
de.hybris.platform.catalog.jalo.classification.util  
de.hybris.platform.catalog.jalo.copy  
de.hybris.platform.catalog.jalo.synccompare  
de.hybris.platform.catalog.jalo.synchronization  
de.hybris.platform.catalog.job  
de.hybris.platform.catalog.job.callback  
de.hybris.platform.catalog.job.callback.impl  
de.hybris.platform.catalog.job.diff  
de.hybris.platform.catalog.job.diff.impl  
de.hybris.platform.catalog.job.sort  
de.hybris.platform.catalog.job.sort.impl  
de.hybris.platform.catalog.job.strategy  
de.hybris.platform.catalog.job.strategy.impl  
de.hybris.platform.catalog.job.util  
de.hybris.platform.catalog.job.util.impl  
de.hybris.platform.catalog.model
Contains generated models for each type of de.hybris.platform.catalog.jalo package.
de.hybris.platform.catalog.model.classification
Contains generated models for each type of de.hybris.platform.catalog.jalo.classification package.
de.hybris.platform.catalog.model.synchronization
Contains generated models for each type of de.hybris.platform.catalog.jalo.synchronization package.
de.hybris.platform.catalog.productreferences.dao  
de.hybris.platform.catalog.references  
de.hybris.platform.catalog.references.daos  
de.hybris.platform.catalog.references.daos.impl  
de.hybris.platform.catalog.references.impl  
de.hybris.platform.catalog.search.preprocessor  
de.hybris.platform.catalog.synchronization  
de.hybris.platform.catalog.synchronization.strategy  
de.hybris.platform.catalog.systemsetup  
de.hybris.platform.category  
de.hybris.platform.category.attribute  
de.hybris.platform.category.constants  
de.hybris.platform.category.daos  
de.hybris.platform.category.daos.impl  
de.hybris.platform.category.impl  
de.hybris.platform.category.interceptors  
de.hybris.platform.category.jalo  
de.hybris.platform.category.model
Contains generated models for each type of de.hybris.platform.category.jalo package.
de.hybris.platform.category.strategies  
de.hybris.platform.category.strategies.impl  
de.hybris.platform.chineseaddressbackoffice.constants  
de.hybris.platform.chineseaddressbackoffice.jalo  
de.hybris.platform.chineseaddressocc.constants  
de.hybris.platform.chineseaddressocc.controllers  
de.hybris.platform.chineseaddressocc.jalo  
de.hybris.platform.chineseaddressocc.validator  
de.hybris.platform.chineseaddressoccaddon.constants  
de.hybris.platform.chineseaddressoccaddon.controllers  
de.hybris.platform.chineseaddressoccaddon.jalo  
de.hybris.platform.chineseaddressoccaddon.validator  
de.hybris.platform.chinesecommerceorgaddressaddon.breadcrumb.impl  
de.hybris.platform.chinesecommerceorgaddressaddon.constants  
de.hybris.platform.chinesecommerceorgaddressaddon.controllers  
de.hybris.platform.chinesecommerceorgaddressaddon.controllers.misc  
de.hybris.platform.chinesecommerceorgaddressaddon.controllers.pages  
de.hybris.platform.chinesecommerceorgaddressaddon.forms  
de.hybris.platform.chinesecommerceorgaddressaddon.forms.validation  
de.hybris.platform.chinesecommerceorgaddressaddon.handlers  
de.hybris.platform.chinesecommerceorgaddressaddon.jalo  
de.hybris.platform.chinesecommerceorgaddressfacades.address.impl  
de.hybris.platform.chinesecommerceorgaddressfacades.constants  
de.hybris.platform.chinesecommerceorgaddressfacades.jalo  
de.hybris.platform.chinesecommercewebservicescommons.constants  
de.hybris.platform.chinesecommercewebservicescommons.dto  
de.hybris.platform.chinesecommercewebservicescommons.jalo  
de.hybris.platform.chineselogisticaddon.constants  
de.hybris.platform.chineselogisticaddon.controllers.imported  
de.hybris.platform.chineselogisticaddon.controllers.pages.checkout.steps  
de.hybris.platform.chineselogisticaddon.decorator  
de.hybris.platform.chineselogisticaddon.jalo  
de.hybris.platform.chineselogisticbackoffice.constants  
de.hybris.platform.chineselogisticbackoffice.jalo  
de.hybris.platform.chineselogisticbackoffice.renderers  
de.hybris.platform.chineselogisticfacades.constants  
de.hybris.platform.chineselogisticfacades.delivery  
de.hybris.platform.chineselogisticfacades.delivery.data  
de.hybris.platform.chineselogisticfacades.delivery.impl  
de.hybris.platform.chineselogisticfacades.delivery.populator  
de.hybris.platform.chineselogisticfacades.jalo  
de.hybris.platform.chineselogisticocc.constants  
de.hybris.platform.chineselogisticocc.controllers  
de.hybris.platform.chineselogisticocc.jalo  
de.hybris.platform.chineselogisticocc.validator  
de.hybris.platform.chineselogisticoccaddon.constants  
de.hybris.platform.chineselogisticoccaddon.controllers  
de.hybris.platform.chineselogisticoccaddon.jalo  
de.hybris.platform.chineselogisticoccaddon.validator  
de.hybris.platform.chineselogisticservices.constants  
de.hybris.platform.chineselogisticservices.delivery  
de.hybris.platform.chineselogisticservices.delivery.dao  
de.hybris.platform.chineselogisticservices.delivery.dao.impl  
de.hybris.platform.chineselogisticservices.delivery.impl  
de.hybris.platform.chineselogisticservices.jalo  
de.hybris.platform.chineselogisticservices.model
Contains generated models for each type of de.hybris.platform.chineselogisticservices.jalo package.
de.hybris.platform.chineselogisticservices.strategies.impl  
de.hybris.platform.chinesepaymentaddon.checkout.steps.validation.impl  
de.hybris.platform.chinesepaymentaddon.constants  
de.hybris.platform.chinesepaymentaddon.controllers.cms  
de.hybris.platform.chinesepaymentaddon.controllers.pages  
de.hybris.platform.chinesepaymentaddon.controllers.pages.checkout.steps  
de.hybris.platform.chinesepaymentaddon.controllers.pages.checkout.steps.imported  
de.hybris.platform.chinesepaymentaddon.controllers.pages.imported  
de.hybris.platform.chinesepaymentaddon.forms  
de.hybris.platform.chinesepaymentaddon.jalo  
de.hybris.platform.chinesepaymentaddon.model
Contains generated models for each type of de.hybris.platform.chinesepaymentaddon.jalo package.
de.hybris.platform.chinesepaymentfacades.checkout  
de.hybris.platform.chinesepaymentfacades.checkout.impl  
de.hybris.platform.chinesepaymentfacades.constants  
de.hybris.platform.chinesepaymentfacades.jalo  
de.hybris.platform.chinesepaymentfacades.order.populator  
de.hybris.platform.chinesepaymentfacades.order.task  
de.hybris.platform.chinesepaymentfacades.payment.data  
de.hybris.platform.chinesepaymentfacades.payment.populator  
de.hybris.platform.chinesepaymentfacades.payment.strategies  
de.hybris.platform.chinesepaymentfacades.payment.strategies.impl  
de.hybris.platform.chinesepaymentmock.constants  
de.hybris.platform.chinesepaymentmock.facades.checkout  
de.hybris.platform.chinesepaymentmock.jalo  
de.hybris.platform.chinesepaymentmock.services  
de.hybris.platform.chinesepaymentocc.constants  
de.hybris.platform.chinesepaymentocc.controllers  
de.hybris.platform.chinesepaymentocc.exceptions  
de.hybris.platform.chinesepaymentocc.jalo  
de.hybris.platform.chinesepaymentocc.validator  
de.hybris.platform.chinesepaymentoccaddon.constants  
de.hybris.platform.chinesepaymentoccaddon.controllers  
de.hybris.platform.chinesepaymentoccaddon.exceptions  
de.hybris.platform.chinesepaymentoccaddon.jalo  
de.hybris.platform.chinesepaymentoccaddon.validator  
de.hybris.platform.chinesepaymentservices.action.order  
de.hybris.platform.chinesepaymentservices.checkout  
de.hybris.platform.chinesepaymentservices.checkout.impl  
de.hybris.platform.chinesepaymentservices.checkout.strategies  
de.hybris.platform.chinesepaymentservices.checkout.strategies.impl  
de.hybris.platform.chinesepaymentservices.constants  
de.hybris.platform.chinesepaymentservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.chinesepaymentservices.exceptions  
de.hybris.platform.chinesepaymentservices.jalo  
de.hybris.platform.chinesepaymentservices.model
Contains generated models for each type of de.hybris.platform.chinesepaymentservices.jalo package.
de.hybris.platform.chinesepaymentservices.order  
de.hybris.platform.chinesepaymentservices.order.dao  
de.hybris.platform.chinesepaymentservices.order.dao.impl  
de.hybris.platform.chinesepaymentservices.order.service  
de.hybris.platform.chinesepaymentservices.order.service.impl  
de.hybris.platform.chinesepaymentservices.payment  
de.hybris.platform.chinesepaymentservices.stocklevel  
de.hybris.platform.chinesepaymentservices.stocklevel.dao  
de.hybris.platform.chinesepaymentservices.stocklevel.dao.impl  
de.hybris.platform.chinesepaymentservices.stocklevel.impl  
de.hybris.platform.chineseproductsharing.constants  
de.hybris.platform.chineseproductsharing.controllers  
de.hybris.platform.chineseproductsharing.controllers.pages  
de.hybris.platform.chineseproductsharingaddon.constants  
de.hybris.platform.chineseproductsharingaddon.jalo  
de.hybris.platform.chineseproductsharingaddon.model
Contains generated models for each type of de.hybris.platform.chineseproductsharingaddon.jalo package.
de.hybris.platform.chineseprofile.constants  
de.hybris.platform.chineseprofile.controllers  
de.hybris.platform.chineseprofile.controllers.pages  
de.hybris.platform.chineseprofile.controllers.pages.imported  
de.hybris.platform.chineseprofile.controllers.pages.misc  
de.hybris.platform.chineseprofile.forms  
de.hybris.platform.chineseprofile.forms.validation  
de.hybris.platform.chineseprofile.jalo  
de.hybris.platform.chineseprofile.model
Contains generated models for each type of de.hybris.platform.chineseprofile.jalo package.
de.hybris.platform.chineseprofilefacades.constants  
de.hybris.platform.chineseprofilefacades.customer  
de.hybris.platform.chineseprofilefacades.customer.impl  
de.hybris.platform.chineseprofilefacades.data  
de.hybris.platform.chineseprofilefacades.jalo  
de.hybris.platform.chineseprofilefacades.populators  
de.hybris.platform.chineseprofilefacades.process.email.context  
de.hybris.platform.chineseprofilefacades.process.email.context.impl  
de.hybris.platform.chineseprofilefacades.strategies  
de.hybris.platform.chineseprofilefacades.strategies.impl  
de.hybris.platform.chineseprofileocc.constants  
de.hybris.platform.chineseprofileocc.controllers  
de.hybris.platform.chineseprofileocc.jalo  
de.hybris.platform.chineseprofileocc.utils  
de.hybris.platform.chineseprofileocc.validator  
de.hybris.platform.chineseprofileoccaddon.constants  
de.hybris.platform.chineseprofileoccaddon.controllers  
de.hybris.platform.chineseprofileoccaddon.jalo  
de.hybris.platform.chineseprofileoccaddon.utils  
de.hybris.platform.chineseprofileoccaddon.validator  
de.hybris.platform.chineseprofileservices.constants  
de.hybris.platform.chineseprofileservices.customer  
de.hybris.platform.chineseprofileservices.customer.impl  
de.hybris.platform.chineseprofileservices.daos  
de.hybris.platform.chineseprofileservices.daos.impl  
de.hybris.platform.chineseprofileservices.data  
de.hybris.platform.chineseprofileservices.jalo  
de.hybris.platform.chineseprofileservices.jobs  
de.hybris.platform.chineseprofileservices.model
Contains generated models for each type of de.hybris.platform.chineseprofileservices.jalo package.
de.hybris.platform.chineseprofileservices.process.email.context  
de.hybris.platform.chineseprofileservices.security  
de.hybris.platform.chineseprofileservices.security.impl  
de.hybris.platform.chineseprofileservices.sms  
de.hybris.platform.chineseprofileservices.sms.impl  
de.hybris.platform.chineseprofileservices.strategies  
de.hybris.platform.chineseprofileservices.strategies.impl  
de.hybris.platform.chineseprofileservices.user.daos.impl  
de.hybris.platform.chinesepspalipaysamplesaddon.constants  
de.hybris.platform.chinesepspalipaysamplesaddon.jalo  
de.hybris.platform.chinesepspalipaysbackoffice.constants  
de.hybris.platform.chinesepspalipaysbackoffice.jalo  
de.hybris.platform.chinesepspalipayservices.alipay  
de.hybris.platform.chinesepspalipayservices.alipay.impl  
de.hybris.platform.chinesepspalipayservices.constants  
de.hybris.platform.chinesepspalipayservices.dao  
de.hybris.platform.chinesepspalipayservices.dao.impl  
de.hybris.platform.chinesepspalipayservices.data  
de.hybris.platform.chinesepspalipayservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.chinesepspalipayservices.exception  
de.hybris.platform.chinesepspalipayservices.jalo  
de.hybris.platform.chinesepspalipayservices.order  
de.hybris.platform.chinesepspalipayservices.order.impl  
de.hybris.platform.chinesepspalipayservices.payment  
de.hybris.platform.chinesepspalipayservices.strategies  
de.hybris.platform.chinesepspalipayservices.strategies.impl  
de.hybris.platform.chinesepspwechatpay.constants  
de.hybris.platform.chinesepspwechatpay.controllers  
de.hybris.platform.chinesepspwechatpay.controllers.misc  
de.hybris.platform.chinesepspwechatpay.controllers.pages  
de.hybris.platform.chinesepspwechatpay.filters  
de.hybris.platform.chinesepspwechatpay.jalo  
de.hybris.platform.chinesepspwechatpaysamplesaddon.constants  
de.hybris.platform.chinesepspwechatpaysamplesaddon.jalo  
de.hybris.platform.chinesepspwechatpaysbackoffice.constants  
de.hybris.platform.chinesepspwechatpaysbackoffice.jalo  
de.hybris.platform.chinesepspwechatpayservices.constants  
de.hybris.platform.chinesepspwechatpayservices.dao  
de.hybris.platform.chinesepspwechatpayservices.dao.impl  
de.hybris.platform.chinesepspwechatpayservices.data  
de.hybris.platform.chinesepspwechatpayservices.exception  
de.hybris.platform.chinesepspwechatpayservices.jalo  
de.hybris.platform.chinesepspwechatpayservices.notifications  
de.hybris.platform.chinesepspwechatpayservices.notifications.impl  
de.hybris.platform.chinesepspwechatpayservices.order  
de.hybris.platform.chinesepspwechatpayservices.order.impl  
de.hybris.platform.chinesepspwechatpayservices.payment.impl  
de.hybris.platform.chinesepspwechatpayservices.processors  
de.hybris.platform.chinesepspwechatpayservices.processors.impl  
de.hybris.platform.chinesepspwechatpayservices.strategies  
de.hybris.platform.chinesepspwechatpayservices.strategies.impl  
de.hybris.platform.chinesepspwechatpayservices.wechatpay  
de.hybris.platform.chinesestoreaddon.constants  
de.hybris.platform.chinesestoreaddon.controllers  
de.hybris.platform.chinesestoreaddon.interceptors.beforeview  
de.hybris.platform.chinesestoreaddon.jalo  
de.hybris.platform.chinesestoreservices.constants  
de.hybris.platform.chinesestoreservices.exception  
de.hybris.platform.chinesestoreservices.jalo  
de.hybris.platform.chinesestoreservices.map  
de.hybris.platform.chinesestoreservices.map.data  
de.hybris.platform.chinesestoreservices.map.impl  
de.hybris.platform.chinesetaxinvoiceaddon.checkout.steps.validation.impl  
de.hybris.platform.chinesetaxinvoiceaddon.constants  
de.hybris.platform.chinesetaxinvoiceaddon.controllers  
de.hybris.platform.chinesetaxinvoiceaddon.controllers.pages.checkout.steps  
de.hybris.platform.chinesetaxinvoiceaddon.decorator  
de.hybris.platform.chinesetaxinvoiceaddon.forms  
de.hybris.platform.chinesetaxinvoiceaddon.forms.validation  
de.hybris.platform.chinesetaxinvoiceaddon.jalo  
de.hybris.platform.chinesetaxinvoicebackoffice.constants  
de.hybris.platform.chinesetaxinvoicebackoffice.jalo  
de.hybris.platform.chinesetaxinvoicebackoffice.renderers  
de.hybris.platform.chinesetaxinvoicefacades.constants  
de.hybris.platform.chinesetaxinvoicefacades.data  
de.hybris.platform.chinesetaxinvoicefacades.facades  
de.hybris.platform.chinesetaxinvoicefacades.facades.impl  
de.hybris.platform.chinesetaxinvoicefacades.jalo  
de.hybris.platform.chinesetaxinvoicefacades.populators  
de.hybris.platform.chinesetaxinvoiceocc.constants  
de.hybris.platform.chinesetaxinvoiceocc.controllers  
de.hybris.platform.chinesetaxinvoiceocc.jalo  
de.hybris.platform.chinesetaxinvoiceocc.validator  
de.hybris.platform.chinesetaxinvoiceoccaddon.constants  
de.hybris.platform.chinesetaxinvoiceoccaddon.controllers  
de.hybris.platform.chinesetaxinvoiceoccaddon.jalo  
de.hybris.platform.chinesetaxinvoiceoccaddon.validator  
de.hybris.platform.chinesetaxinvoiceservices.constants  
de.hybris.platform.chinesetaxinvoiceservices.daos  
de.hybris.platform.chinesetaxinvoiceservices.daos.impl  
de.hybris.platform.chinesetaxinvoiceservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.chinesetaxinvoiceservices.jalo  
de.hybris.platform.chinesetaxinvoiceservices.model
Contains generated models for each type of de.hybris.platform.chinesetaxinvoiceservices.jalo package.
de.hybris.platform.chinesetaxinvoiceservices.services  
de.hybris.platform.chinesetaxinvoiceservices.services.impl  
de.hybris.platform.cissubscription.data  
de.hybris.platform.classification  
de.hybris.platform.classification.daos  
de.hybris.platform.classification.daos.impl  
de.hybris.platform.classification.features  
de.hybris.platform.classification.filter  
de.hybris.platform.classification.impl  
de.hybris.platform.classification.interceptors  
de.hybris.platform.classification.strategy  
de.hybris.platform.classification.strategy.impl  
de.hybris.platform.cluster  
de.hybris.platform.cluster.jgroups  
de.hybris.platform.cluster.legacy  
de.hybris.platform.cluster.udp  
de.hybris.platform.cms2.catalogversion.service  
de.hybris.platform.cms2.catalogversion.service.impl  
de.hybris.platform.cms2.cloning.service  
de.hybris.platform.cms2.cloning.service.impl  
de.hybris.platform.cms2.cloning.service.predicate  
de.hybris.platform.cms2.cloning.service.preset  
de.hybris.platform.cms2.cloning.service.preset.impl  
de.hybris.platform.cms2.cloning.strategy  
de.hybris.platform.cms2.cloning.strategy.impl  
de.hybris.platform.cms2.cmsitems.converter  
de.hybris.platform.cms2.cmsitems.converter.impl  
de.hybris.platform.cms2.cmsitems.service  
de.hybris.platform.cms2.cmsitems.service.impl  
de.hybris.platform.cms2.common.annotations  
de.hybris.platform.cms2.common.exceptions  
de.hybris.platform.cms2.common.functions  
de.hybris.platform.cms2.common.functions.impl  
de.hybris.platform.cms2.common.predicate  
de.hybris.platform.cms2.common.predicates  
de.hybris.platform.cms2.common.service  
de.hybris.platform.cms2.common.service.impl  
de.hybris.platform.cms2.constants  
de.hybris.platform.cms2.data  
de.hybris.platform.cms2.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.cms2.events  
de.hybris.platform.cms2.exceptions  
de.hybris.platform.cms2.items.service  
de.hybris.platform.cms2.items.service.impl  
de.hybris.platform.cms2.jalo  
de.hybris.platform.cms2.jalo.contents  
de.hybris.platform.cms2.jalo.contents.components  
de.hybris.platform.cms2.jalo.contents.containers  
de.hybris.platform.cms2.jalo.contents.contentslot  
de.hybris.platform.cms2.jalo.navigation  
de.hybris.platform.cms2.jalo.pages  
de.hybris.platform.cms2.jalo.preview  
de.hybris.platform.cms2.jalo.relations  
de.hybris.platform.cms2.jalo.restrictions  
de.hybris.platform.cms2.jalo.site  
de.hybris.platform.cms2.misc  
de.hybris.platform.cms2.model
Contains generated models for each type of de.hybris.platform.cms2.jalo package.
de.hybris.platform.cms2.model.contents
Contains generated models for each type of de.hybris.platform.cms2.jalo.contents package.
de.hybris.platform.cms2.model.contents.components
Contains generated models for each type of de.hybris.platform.cms2.jalo.contents.components package.
de.hybris.platform.cms2.model.contents.containers
Contains generated models for each type of de.hybris.platform.cms2.jalo.contents.containers package.
de.hybris.platform.cms2.model.contents.contentslot
Contains generated models for each type of de.hybris.platform.cms2.jalo.contents.contentslot package.
de.hybris.platform.cms2.model.navigation
Contains generated models for each type of de.hybris.platform.cms2.jalo.navigation package.
de.hybris.platform.cms2.model.pages
Contains generated models for each type of de.hybris.platform.cms2.jalo.pages package.
de.hybris.platform.cms2.model.preview
Contains generated models for each type of de.hybris.platform.cms2.jalo.preview package.
de.hybris.platform.cms2.model.relations
Contains generated models for each type of de.hybris.platform.cms2.jalo.relations package.
de.hybris.platform.cms2.model.restrictions
Contains generated models for each type of de.hybris.platform.cms2.jalo.restrictions package.
de.hybris.platform.cms2.model.site
Contains generated models for each type of de.hybris.platform.cms2.jalo.site package.
de.hybris.platform.cms2.multicountry.comparator  
de.hybris.platform.cms2.multicountry.service  
de.hybris.platform.cms2.multicountry.service.impl  
de.hybris.platform.cms2.namedquery  
de.hybris.platform.cms2.namedquery.service  
de.hybris.platform.cms2.namedquery.service.impl  
de.hybris.platform.cms2.permissions  
de.hybris.platform.cms2.permissions.impl  
de.hybris.platform.cms2.registry  
de.hybris.platform.cms2.registry.impl  
de.hybris.platform.cms2.relateditems  
de.hybris.platform.cms2.relateditems.impl  
de.hybris.platform.cms2.relateditems.visitors  
de.hybris.platform.cms2.relateditems.visitors.page  
de.hybris.platform.cms2.relatedpages  
de.hybris.platform.cms2.relatedpages.impl  
de.hybris.platform.cms2.relatedpages.service  
de.hybris.platform.cms2.relatedpages.service.impl  
de.hybris.platform.cms2.servicelayer.daos  
de.hybris.platform.cms2.servicelayer.daos.impl  
de.hybris.platform.cms2.servicelayer.data  
de.hybris.platform.cms2.servicelayer.data.impl  
de.hybris.platform.cms2.servicelayer.interceptor.impl  
de.hybris.platform.cms2.servicelayer.interceptor.impl.service  
de.hybris.platform.cms2.servicelayer.interceptor.service  
de.hybris.platform.cms2.servicelayer.interceptor.service.impl  
de.hybris.platform.cms2.servicelayer.resolvers  
de.hybris.platform.cms2.servicelayer.services  
de.hybris.platform.cms2.servicelayer.services.admin  
de.hybris.platform.cms2.servicelayer.services.admin.impl  
de.hybris.platform.cms2.servicelayer.services.evaluator  
de.hybris.platform.cms2.servicelayer.services.evaluator.impl  
de.hybris.platform.cms2.servicelayer.services.impl  
de.hybris.platform.cms2.services  
de.hybris.platform.cms2.services.impl  
de.hybris.platform.cms2.services.meta.impl  
de.hybris.platform.cms2.strategies  
de.hybris.platform.cms2.strategies.impl  
de.hybris.platform.cms2.systemsetup  
de.hybris.platform.cms2.usergroups.service  
de.hybris.platform.cms2.usergroups.service.impl  
de.hybris.platform.cms2.version  
de.hybris.platform.cms2.version.converter.attribute.data  
de.hybris.platform.cms2.version.converter.attribute.impl  
de.hybris.platform.cms2.version.converter.customattribute  
de.hybris.platform.cms2.version.converter.customattribute.data  
de.hybris.platform.cms2.version.converter.customattribute.impl  
de.hybris.platform.cms2.version.converter.impl  
de.hybris.platform.cms2.version.converter.rollback  
de.hybris.platform.cms2.version.converter.rollback.impl  
de.hybris.platform.cms2.version.populator  
de.hybris.platform.cms2.version.predicate  
de.hybris.platform.cms2.version.service  
de.hybris.platform.cms2.version.service.impl  
de.hybris.platform.cms2.version.strategies  
de.hybris.platform.cms2.version.strategies.impl  
de.hybris.platform.cms2.workflow.actions  
de.hybris.platform.cms2.workflow.service  
de.hybris.platform.cms2.workflow.service.impl  
de.hybris.platform.cms2lib.cmstags  
de.hybris.platform.cms2lib.components  
de.hybris.platform.cms2lib.components.interceptors  
de.hybris.platform.cms2lib.constants  
de.hybris.platform.cms2lib.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.cms2lib.jalo  
de.hybris.platform.cms2lib.model.components
Contains generated models for each type of de.hybris.platform.cms2lib.components package.
de.hybris.platform.cmsbackoffice.constants  
de.hybris.platform.cmsbackoffice.jalo  
de.hybris.platform.cmscockpit  
de.hybris.platform.cmscockpit.callbackevents  
de.hybris.platform.cmscockpit.cms.events  
de.hybris.platform.cmscockpit.cms.strategies  
de.hybris.platform.cmscockpit.cms.strategies.impl  
de.hybris.platform.cmscockpit.components.contentbrowser  
de.hybris.platform.cmscockpit.components.contentbrowser.message  
de.hybris.platform.cmscockpit.components.editor  
de.hybris.platform.cmscockpit.components.editor.impl  
de.hybris.platform.cmscockpit.components.editorarea  
de.hybris.platform.cmscockpit.components.editorarea.model  
de.hybris.platform.cmscockpit.components.editorarea.view  
de.hybris.platform.cmscockpit.components.inspector.impl  
de.hybris.platform.cmscockpit.components.listsectionbrowser.impl  
de.hybris.platform.cmscockpit.components.listview  
de.hybris.platform.cmscockpit.components.listview.impl  
de.hybris.platform.cmscockpit.components.liveedit  
de.hybris.platform.cmscockpit.components.liveedit.converter  
de.hybris.platform.cmscockpit.components.liveedit.impl  
de.hybris.platform.cmscockpit.components.login  
de.hybris.platform.cmscockpit.components.navigationarea  
de.hybris.platform.cmscockpit.components.navigationarea.renderer  
de.hybris.platform.cmscockpit.components.sectionpanel  
de.hybris.platform.cmscockpit.components.sectionpanel.renderer  
de.hybris.platform.cmscockpit.components.welcomepage  
de.hybris.platform.cmscockpit.components.zk  
de.hybris.platform.cmscockpit.constants  
de.hybris.platform.cmscockpit.converter.impl  
de.hybris.platform.cmscockpit.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.cmscockpit.err  
de.hybris.platform.cmscockpit.events.impl  
de.hybris.platform.cmscockpit.filters  
de.hybris.platform.cmscockpit.injectors  
de.hybris.platform.cmscockpit.injectors.impl  
de.hybris.platform.cmscockpit.jalo  
de.hybris.platform.cmscockpit.model.gridview.impl  
de.hybris.platform.cmscockpit.navigationnode.browserarea.list  
de.hybris.platform.cmscockpit.navigationnode.browserarea.tree  
de.hybris.platform.cmscockpit.resolvers  
de.hybris.platform.cmscockpit.services  
de.hybris.platform.cmscockpit.services.config  
de.hybris.platform.cmscockpit.services.config.impl  
de.hybris.platform.cmscockpit.services.config.jaxb.contenteditor  
de.hybris.platform.cmscockpit.services.config.jaxb.contentelement  
de.hybris.platform.cmscockpit.services.impl  
de.hybris.platform.cmscockpit.services.label.impl  
de.hybris.platform.cmscockpit.services.login.impl  
de.hybris.platform.cmscockpit.services.security.impl  
de.hybris.platform.cmscockpit.services.workflow.impl  
de.hybris.platform.cmscockpit.session  
de.hybris.platform.cmscockpit.session.impl  
de.hybris.platform.cmscockpit.session.script  
de.hybris.platform.cmscockpit.session.script.components  
de.hybris.platform.cmscockpit.session.script.config  
de.hybris.platform.cmscockpit.session.script.config.impl  
de.hybris.platform.cmscockpit.sync  
de.hybris.platform.cmscockpit.systemsetup  
de.hybris.platform.cmscockpit.url.impl  
de.hybris.platform.cmscockpit.util  
de.hybris.platform.cmscockpit.wizard  
de.hybris.platform.cmscockpit.wizard.cmssite  
de.hybris.platform.cmscockpit.wizard.cmssite.controllers  
de.hybris.platform.cmscockpit.wizard.cmssite.pages  
de.hybris.platform.cmscockpit.wizard.cmssite.util  
de.hybris.platform.cmscockpit.wizard.controller  
de.hybris.platform.cmscockpit.wizard.page  
de.hybris.platform.cmscockpit.wizard.strategies  
de.hybris.platform.cmsfacades  
de.hybris.platform.cmsfacades.catalogs.populator  
de.hybris.platform.cmsfacades.catalogversions  
de.hybris.platform.cmsfacades.catalogversions.comparator  
de.hybris.platform.cmsfacades.catalogversions.impl  
de.hybris.platform.cmsfacades.catalogversions.populator  
de.hybris.platform.cmsfacades.catalogversions.service  
de.hybris.platform.cmsfacades.catalogversions.service.impl  
de.hybris.platform.cmsfacades.cmsitems  
de.hybris.platform.cmsfacades.cmsitems.attributeconverters  
de.hybris.platform.cmsfacades.cmsitems.attributevalidators  
de.hybris.platform.cmsfacades.cmsitems.converter  
de.hybris.platform.cmsfacades.cmsitems.impl  
de.hybris.platform.cmsfacades.cmsitems.populators  
de.hybris.platform.cmsfacades.cmsitems.predicates  
de.hybris.platform.cmsfacades.cmsitems.properties  
de.hybris.platform.cmsfacades.cmsitems.properties.impl  
de.hybris.platform.cmsfacades.cmsitems.validator  
de.hybris.platform.cmsfacades.common.function  
de.hybris.platform.cmsfacades.common.function.impl  
de.hybris.platform.cmsfacades.common.itemcollector  
de.hybris.platform.cmsfacades.common.itemcollector.impl  
de.hybris.platform.cmsfacades.common.populator  
de.hybris.platform.cmsfacades.common.populator.impl  
de.hybris.platform.cmsfacades.common.predicate  
de.hybris.platform.cmsfacades.common.predicate.attributes  
de.hybris.platform.cmsfacades.common.service  
de.hybris.platform.cmsfacades.common.service.impl  
de.hybris.platform.cmsfacades.common.validator  
de.hybris.platform.cmsfacades.common.validator.impl  
de.hybris.platform.cmsfacades.constants  
de.hybris.platform.cmsfacades.daos  
de.hybris.platform.cmsfacades.daos.impl  
de.hybris.platform.cmsfacades.data  
de.hybris.platform.cmsfacades.dto  
de.hybris.platform.cmsfacades.enums  
de.hybris.platform.cmsfacades.exception  
de.hybris.platform.cmsfacades.factory  
de.hybris.platform.cmsfacades.factory.impl  
de.hybris.platform.cmsfacades.header  
de.hybris.platform.cmsfacades.items  
de.hybris.platform.cmsfacades.items.impl  
de.hybris.platform.cmsfacades.jalo  
de.hybris.platform.cmsfacades.languages  
de.hybris.platform.cmsfacades.languages.impl  
de.hybris.platform.cmsfacades.media  
de.hybris.platform.cmsfacades.media.impl  
de.hybris.platform.cmsfacades.media.namedquery  
de.hybris.platform.cmsfacades.media.populator  
de.hybris.platform.cmsfacades.media.service  
de.hybris.platform.cmsfacades.media.service.impl  
de.hybris.platform.cmsfacades.media.validator  
de.hybris.platform.cmsfacades.media.validator.predicate  
de.hybris.platform.cmsfacades.mediacontainers  
de.hybris.platform.cmsfacades.mediacontainers.impl  
de.hybris.platform.cmsfacades.model
Contains generated models for each type of de.hybris.platform.cmsfacades.jalo package.
de.hybris.platform.cmsfacades.namedquery.validator  
de.hybris.platform.cmsfacades.navigationentrytypes  
de.hybris.platform.cmsfacades.navigationentrytypes.impl  
de.hybris.platform.cmsfacades.navigations  
de.hybris.platform.cmsfacades.navigations.impl  
de.hybris.platform.cmsfacades.navigations.populator.data  
de.hybris.platform.cmsfacades.navigations.populator.model  
de.hybris.platform.cmsfacades.navigations.service  
de.hybris.platform.cmsfacades.navigations.service.converters  
de.hybris.platform.cmsfacades.navigations.service.functions  
de.hybris.platform.cmsfacades.navigations.service.impl  
de.hybris.platform.cmsfacades.navigations.validator  
de.hybris.platform.cmsfacades.navigations.validator.predicate  
de.hybris.platform.cmsfacades.page  
de.hybris.platform.cmsfacades.pages  
de.hybris.platform.cmsfacades.pages.comparator  
de.hybris.platform.cmsfacades.pages.impl  
de.hybris.platform.cmsfacades.pages.populator.data  
de.hybris.platform.cmsfacades.pages.populator.model  
de.hybris.platform.cmsfacades.pages.service  
de.hybris.platform.cmsfacades.pages.service.impl  
de.hybris.platform.cmsfacades.pages.validator  
de.hybris.platform.cmsfacades.pagescontentslots  
de.hybris.platform.cmsfacades.pagescontentslots.converter  
de.hybris.platform.cmsfacades.pagescontentslots.impl  
de.hybris.platform.cmsfacades.pagescontentslots.populator  
de.hybris.platform.cmsfacades.pagescontentslots.service  
de.hybris.platform.cmsfacades.pagescontentslots.service.impl  
de.hybris.platform.cmsfacades.pagescontentslotscomponents  
de.hybris.platform.cmsfacades.pagescontentslotscomponents.impl  
de.hybris.platform.cmsfacades.pagescontentslotscomponents.validator  
de.hybris.platform.cmsfacades.pagescontentslotscomponents.validator.predicate  
de.hybris.platform.cmsfacades.pagescontentslotscontainers  
de.hybris.platform.cmsfacades.pagescontentslotscontainers.impl  
de.hybris.platform.cmsfacades.pagescontentslotstyperestrictions  
de.hybris.platform.cmsfacades.pagescontentslotstyperestrictions.impl  
de.hybris.platform.cmsfacades.pagescontentslotstyperestrictions.validator  
de.hybris.platform.cmsfacades.pagesrestrictions  
de.hybris.platform.cmsfacades.pagesrestrictions.impl  
de.hybris.platform.cmsfacades.pagesrestrictions.validator  
de.hybris.platform.cmsfacades.pagetemplates  
de.hybris.platform.cmsfacades.pagetemplates.impl  
de.hybris.platform.cmsfacades.pagetemplates.populator  
de.hybris.platform.cmsfacades.pagetypesrestrictiontypes  
de.hybris.platform.cmsfacades.pagetypesrestrictiontypes.impl  
de.hybris.platform.cmsfacades.products  
de.hybris.platform.cmsfacades.products.impl  
de.hybris.platform.cmsfacades.products.populator  
de.hybris.platform.cmsfacades.products.service  
de.hybris.platform.cmsfacades.products.service.impl  
de.hybris.platform.cmsfacades.rendering  
de.hybris.platform.cmsfacades.rendering.attributeconverters  
de.hybris.platform.cmsfacades.rendering.cache  
de.hybris.platform.cmsfacades.rendering.cache.dto  
de.hybris.platform.cmsfacades.rendering.cache.impl  
de.hybris.platform.cmsfacades.rendering.cache.keyprovider  
de.hybris.platform.cmsfacades.rendering.cache.keyprovider.item  
de.hybris.platform.cmsfacades.rendering.converter  
de.hybris.platform.cmsfacades.rendering.impl  
de.hybris.platform.cmsfacades.rendering.populators  
de.hybris.platform.cmsfacades.rendering.predicates.attributes  
de.hybris.platform.cmsfacades.rendering.strategies  
de.hybris.platform.cmsfacades.rendering.suppliers.page  
de.hybris.platform.cmsfacades.rendering.suppliers.page.impl  
de.hybris.platform.cmsfacades.rendering.validators.component  
de.hybris.platform.cmsfacades.rendering.validators.page  
de.hybris.platform.cmsfacades.rendering.validators.page.impl  
de.hybris.platform.cmsfacades.rendering.visibility  
de.hybris.platform.cmsfacades.rendering.visibility.impl  
de.hybris.platform.cmsfacades.resolvers.sites  
de.hybris.platform.cmsfacades.resolvers.sites.impl  
de.hybris.platform.cmsfacades.restrictions  
de.hybris.platform.cmsfacades.restrictions.impl  
de.hybris.platform.cmsfacades.sites  
de.hybris.platform.cmsfacades.sites.impl  
de.hybris.platform.cmsfacades.sites.populator.model  
de.hybris.platform.cmsfacades.synchronization  
de.hybris.platform.cmsfacades.synchronization.cache  
de.hybris.platform.cmsfacades.synchronization.cache.impl  
de.hybris.platform.cmsfacades.synchronization.impl  
de.hybris.platform.cmsfacades.synchronization.itemcollector  
de.hybris.platform.cmsfacades.synchronization.itemvisitors  
de.hybris.platform.cmsfacades.synchronization.itemvisitors.impl  
de.hybris.platform.cmsfacades.synchronization.populator  
de.hybris.platform.cmsfacades.synchronization.service  
de.hybris.platform.cmsfacades.synchronization.service.impl  
de.hybris.platform.cmsfacades.synchronization.validator  
de.hybris.platform.cmsfacades.types  
de.hybris.platform.cmsfacades.types.converter  
de.hybris.platform.cmsfacades.types.impl  
de.hybris.platform.cmsfacades.types.modepredicates  
de.hybris.platform.cmsfacades.types.populator  
de.hybris.platform.cmsfacades.types.service  
de.hybris.platform.cmsfacades.types.service.impl  
de.hybris.platform.cmsfacades.types.service.populator  
de.hybris.platform.cmsfacades.types.service.predicate  
de.hybris.platform.cmsfacades.types.service.validator  
de.hybris.platform.cmsfacades.types.validator  
de.hybris.platform.cmsfacades.uniqueidentifier  
de.hybris.platform.cmsfacades.uniqueidentifier.functions  
de.hybris.platform.cmsfacades.uniqueidentifier.impl  
de.hybris.platform.cmsfacades.uniqueidentifier.populator  
de.hybris.platform.cmsfacades.usergroups  
de.hybris.platform.cmsfacades.usergroups.impl  
de.hybris.platform.cmsfacades.usergroups.populator  
de.hybris.platform.cmsfacades.users  
de.hybris.platform.cmsfacades.users.impl  
de.hybris.platform.cmsfacades.users.populator  
de.hybris.platform.cmsfacades.users.services  
de.hybris.platform.cmsfacades.users.services.impl  
de.hybris.platform.cmsfacades.util  
de.hybris.platform.cmsfacades.util.builder  
de.hybris.platform.cmsfacades.util.dao  
de.hybris.platform.cmsfacades.util.dao.impl  
de.hybris.platform.cmsfacades.util.models  
de.hybris.platform.cmsfacades.validator.data  
de.hybris.platform.cmsfacades.version  
de.hybris.platform.cmsfacades.version.impl  
de.hybris.platform.cmsfacades.version.populator  
de.hybris.platform.cmsfacades.version.predicate  
de.hybris.platform.cmsfacades.version.validator  
de.hybris.platform.cmsfacades.workflow  
de.hybris.platform.cmsfacades.workflow.impl  
de.hybris.platform.cmsfacades.workflow.populator  
de.hybris.platform.cmsfacades.workflow.postaction  
de.hybris.platform.cmsfacades.workflow.postaction.impl  
de.hybris.platform.cmsfacades.workflow.service  
de.hybris.platform.cmsfacades.workflow.service.impl  
de.hybris.platform.cmsfacades.workflow.validator  
de.hybris.platform.cmsocc.constants  
de.hybris.platform.cmsocc.controllers  
de.hybris.platform.cmsocc.data  
de.hybris.platform.cmsocc.filter  
de.hybris.platform.cmsocc.jalo  
de.hybris.platform.cmsocc.jaxb  
de.hybris.platform.cmsocc.jaxb.adapters  
de.hybris.platform.cmsocc.jaxb.adapters.components  
de.hybris.platform.cmsocc.jaxb.adapters.pages  
de.hybris.platform.cmsocc.jaxb.adapters.slots  
de.hybris.platform.cmsocc.mapping  
de.hybris.platform.cmsocc.mapping.converters  
de.hybris.platform.cmsocc.properties.suppliers  
de.hybris.platform.cmsocc.redirect.strategies  
de.hybris.platform.cmsocc.redirect.strategies.impl  
de.hybris.platform.cmsocc.redirect.suppliers  
de.hybris.platform.cmsocc.redirect.suppliers.impl  
de.hybris.platform.cmsoccaddon.constants  
de.hybris.platform.cmsoccaddon.controllers  
de.hybris.platform.cmsoccaddon.data  
de.hybris.platform.cmsoccaddon.filter  
de.hybris.platform.cmsoccaddon.jalo  
de.hybris.platform.cmsoccaddon.jaxb  
de.hybris.platform.cmsoccaddon.jaxb.adapters  
de.hybris.platform.cmsoccaddon.jaxb.adapters.components  
de.hybris.platform.cmsoccaddon.jaxb.adapters.pages  
de.hybris.platform.cmsoccaddon.jaxb.adapters.slots  
de.hybris.platform.cmsoccaddon.mapping  
de.hybris.platform.cmsoccaddon.mapping.converters  
de.hybris.platform.cmsoccaddon.properties.suppliers  
de.hybris.platform.cmsoccaddon.redirect.strategies  
de.hybris.platform.cmsoccaddon.redirect.strategies.impl  
de.hybris.platform.cmsoccaddon.redirect.suppliers  
de.hybris.platform.cmsoccaddon.redirect.suppliers.impl  
de.hybris.platform.cmssmarteditwebservices.catalogs  
de.hybris.platform.cmssmarteditwebservices.catalogs.controller  
de.hybris.platform.cmssmarteditwebservices.catalogs.impl  
de.hybris.platform.cmssmarteditwebservices.catalogs.populator  
de.hybris.platform.cmssmarteditwebservices.config  
de.hybris.platform.cmssmarteditwebservices.constants  
de.hybris.platform.cmssmarteditwebservices.data  
de.hybris.platform.cmssmarteditwebservices.dto  
de.hybris.platform.cmssmarteditwebservices.filter  
de.hybris.platform.cmssmarteditwebservices.inbox.controller  
de.hybris.platform.cmssmarteditwebservices.interceptor  
de.hybris.platform.cmssmarteditwebservices.jalo  
de.hybris.platform.cmssmarteditwebservices.jaxb.adapters  
de.hybris.platform.cmssmarteditwebservices.pages.controller  
de.hybris.platform.cmssmarteditwebservices.products.controller  
de.hybris.platform.cmssmarteditwebservices.products.facade  
de.hybris.platform.cmssmarteditwebservices.products.facade.impl  
de.hybris.platform.cmssmarteditwebservices.products.facade.populator  
de.hybris.platform.cmssmarteditwebservices.synchronization.controller  
de.hybris.platform.cmssmarteditwebservices.workflow.controller  
de.hybris.platform.cmswebservices  
de.hybris.platform.cmswebservices.catalogversions.controller  
de.hybris.platform.cmswebservices.cmsitems.controller  
de.hybris.platform.cmswebservices.config  
de.hybris.platform.cmswebservices.constants  
de.hybris.platform.cmswebservices.controller  
de.hybris.platform.cmswebservices.data  
de.hybris.platform.cmswebservices.dto  
de.hybris.platform.cmswebservices.exception  
de.hybris.platform.cmswebservices.filter  
de.hybris.platform.cmswebservices.interceptor  
de.hybris.platform.cmswebservices.jalo  
de.hybris.platform.cmswebservices.jaxb.adapters  
de.hybris.platform.cmswebservices.languages.controller  
de.hybris.platform.cmswebservices.media.controller  
de.hybris.platform.cmswebservices.namedquery  
de.hybris.platform.cmswebservices.navigationentrytypes.controller  
de.hybris.platform.cmswebservices.navigations.controller  
de.hybris.platform.cmswebservices.orika.converter  
de.hybris.platform.cmswebservices.pages.controller  
de.hybris.platform.cmswebservices.pagescontentslots.controller  
de.hybris.platform.cmswebservices.pagescontentslotscomponents.controller  
de.hybris.platform.cmswebservices.pagescontentslotscontainers.controller  
de.hybris.platform.cmswebservices.pagescontentslotstyperestrictions.controller  
de.hybris.platform.cmswebservices.pagesrestrictions.controller  
de.hybris.platform.cmswebservices.pagetemplates.controller  
de.hybris.platform.cmswebservices.products.controller  
de.hybris.platform.cmswebservices.resolvers  
de.hybris.platform.cmswebservices.resolvers.impl  
de.hybris.platform.cmswebservices.restrictions.controller  
de.hybris.platform.cmswebservices.security  
de.hybris.platform.cmswebservices.sites.controller  
de.hybris.platform.cmswebservices.synchronization.controller  
de.hybris.platform.cmswebservices.types.controller  
de.hybris.platform.cmswebservices.usergroups.controller  
de.hybris.platform.cmswebservices.users.controller  
de.hybris.platform.cmswebservices.validator  
de.hybris.platform.cmswebservices.version.controller  
de.hybris.platform.cmswebservices.workflows.controller  
de.hybris.platform.cmswebservices.workflowtemplates.controller  
de.hybris.platform.cockpit  
de.hybris.platform.cockpit.aop  
de.hybris.platform.cockpit.cache  
de.hybris.platform.cockpit.comments.exceptions  
de.hybris.platform.cockpit.comments.strategies  
de.hybris.platform.cockpit.comments.strategies.impl  
de.hybris.platform.cockpit.components  
de.hybris.platform.cockpit.components.contentbrowser  
de.hybris.platform.cockpit.components.contentbrowser.browsercomponents  
de.hybris.platform.cockpit.components.contentbrowser.comments  
de.hybris.platform.cockpit.components.dialog  
de.hybris.platform.cockpit.components.duallistbox  
de.hybris.platform.cockpit.components.duallistbox.impl  
de.hybris.platform.cockpit.components.editor  
de.hybris.platform.cockpit.components.editorarea  
de.hybris.platform.cockpit.components.editorarea.export  
de.hybris.platform.cockpit.components.editorarea.renderer  
de.hybris.platform.cockpit.components.impl  
de.hybris.platform.cockpit.components.inspector  
de.hybris.platform.cockpit.components.inspector.impl  
de.hybris.platform.cockpit.components.listeditor  
de.hybris.platform.cockpit.components.listeners  
de.hybris.platform.cockpit.components.listview  
de.hybris.platform.cockpit.components.listview.impl  
de.hybris.platform.cockpit.components.login  
de.hybris.platform.cockpit.components.menu  
de.hybris.platform.cockpit.components.menu.impl  
de.hybris.platform.cockpit.components.mvc  
de.hybris.platform.cockpit.components.mvc.commentlayer  
de.hybris.platform.cockpit.components.mvc.commentlayer.controller  
de.hybris.platform.cockpit.components.mvc.commentlayer.controller.impl  
de.hybris.platform.cockpit.components.mvc.commentlayer.model  
de.hybris.platform.cockpit.components.mvc.listbox  
de.hybris.platform.cockpit.components.mvc.listbox.listeners  
de.hybris.platform.cockpit.components.mvc.listbox.view  
de.hybris.platform.cockpit.components.mvc.tree  
de.hybris.platform.cockpit.components.mvc.tree.events  
de.hybris.platform.cockpit.components.mvc.tree.listeners  
de.hybris.platform.cockpit.components.mvc.tree.view  
de.hybris.platform.cockpit.components.navigationarea  
de.hybris.platform.cockpit.components.navigationarea.model  
de.hybris.platform.cockpit.components.navigationarea.renderer  
de.hybris.platform.cockpit.components.navigationarea.workflow.visualization  
de.hybris.platform.cockpit.components.navigationarea.workflow.visualization.components  
de.hybris.platform.cockpit.components.navigationarea.workflow.visualization.menu  
de.hybris.platform.cockpit.components.navigationarea.workflow.visualization.menu.entries  
de.hybris.platform.cockpit.components.navigationarea.workflow.visualization.servlet  
de.hybris.platform.cockpit.components.notifier  
de.hybris.platform.cockpit.components.search  
de.hybris.platform.cockpit.components.sectionpanel  
de.hybris.platform.cockpit.components.sync.dialog  
de.hybris.platform.cockpit.constants  
de.hybris.platform.cockpit.coverage.strategies.impl  
de.hybris.platform.cockpit.daos  
de.hybris.platform.cockpit.daos.impl  
de.hybris.platform.cockpit.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.cockpit.err  
de.hybris.platform.cockpit.events  
de.hybris.platform.cockpit.events.impl  
de.hybris.platform.cockpit.forms.login  
de.hybris.platform.cockpit.helpers  
de.hybris.platform.cockpit.helpers.impl  
de.hybris.platform.cockpit.helpers.validation  
de.hybris.platform.cockpit.impl  
de.hybris.platform.cockpit.interceptor  
de.hybris.platform.cockpit.jalo  
de.hybris.platform.cockpit.jalo.template  
de.hybris.platform.cockpit.model
Contains generated models for each type of de.hybris.platform.cockpit.jalo package.
de.hybris.platform.cockpit.model.advancedsearch  
de.hybris.platform.cockpit.model.advancedsearch.config  
de.hybris.platform.cockpit.model.advancedsearch.config.impl  
de.hybris.platform.cockpit.model.advancedsearch.impl  
de.hybris.platform.cockpit.model.browser  
de.hybris.platform.cockpit.model.browser.impl  
de.hybris.platform.cockpit.model.collection  
de.hybris.platform.cockpit.model.collection.impl  
de.hybris.platform.cockpit.model.config  
de.hybris.platform.cockpit.model.dynamicquery  
de.hybris.platform.cockpit.model.dynamicquery.impl  
de.hybris.platform.cockpit.model.editor  
de.hybris.platform.cockpit.model.editor.impl  
de.hybris.platform.cockpit.model.editor.search  
de.hybris.platform.cockpit.model.editor.search.impl  
de.hybris.platform.cockpit.model.general  
de.hybris.platform.cockpit.model.general.impl  
de.hybris.platform.cockpit.model.gridview  
de.hybris.platform.cockpit.model.gridview.impl  
de.hybris.platform.cockpit.model.listview  
de.hybris.platform.cockpit.model.listview.impl  
de.hybris.platform.cockpit.model.login  
de.hybris.platform.cockpit.model.meta  
de.hybris.platform.cockpit.model.meta.impl  
de.hybris.platform.cockpit.model.misc  
de.hybris.platform.cockpit.model.query.impl  
de.hybris.platform.cockpit.model.referenceeditor  
de.hybris.platform.cockpit.model.referenceeditor.celum.impl  
de.hybris.platform.cockpit.model.referenceeditor.collection  
de.hybris.platform.cockpit.model.referenceeditor.collection.controller  
de.hybris.platform.cockpit.model.referenceeditor.collection.model  
de.hybris.platform.cockpit.model.referenceeditor.collection.model.media  
de.hybris.platform.cockpit.model.referenceeditor.impl  
de.hybris.platform.cockpit.model.referenceeditor.simple  
de.hybris.platform.cockpit.model.referenceeditor.simple.impl  
de.hybris.platform.cockpit.model.search  
de.hybris.platform.cockpit.model.search.impl  
de.hybris.platform.cockpit.model.template
Contains generated models for each type of de.hybris.platform.cockpit.jalo.template package.
de.hybris.platform.cockpit.model.undo  
de.hybris.platform.cockpit.model.undo.impl  
de.hybris.platform.cockpit.reports  
de.hybris.platform.cockpit.reports.components.contentbrowser  
de.hybris.platform.cockpit.reports.components.perspective  
de.hybris.platform.cockpit.reports.constants  
de.hybris.platform.cockpit.reports.customizer  
de.hybris.platform.cockpit.reports.editorarea  
de.hybris.platform.cockpit.reports.exceptions  
de.hybris.platform.cockpit.reports.factories  
de.hybris.platform.cockpit.reports.factories.impl  
de.hybris.platform.cockpit.reports.impl  
de.hybris.platform.cockpit.reports.integrationtests  
de.hybris.platform.cockpit.reports.interceptor  
de.hybris.platform.cockpit.reports.jalo  
de.hybris.platform.cockpit.reports.jasperreports  
de.hybris.platform.cockpit.reports.model
Contains generated models for each type of de.hybris.platform.cockpit.reports.jalo package.
de.hybris.platform.cockpit.reports.scriptlets  
de.hybris.platform.cockpit.reports.widgets  
de.hybris.platform.cockpit.reports.widgets.converter  
de.hybris.platform.cockpit.reports.widgets.converter.impl  
de.hybris.platform.cockpit.reports.widgets.factory  
de.hybris.platform.cockpit.reports.widgets.factory.impl  
de.hybris.platform.cockpit.reports.widgets.util  
de.hybris.platform.cockpit.reports.wizards  
de.hybris.platform.cockpit.security  
de.hybris.platform.cockpit.security.exceptions  
de.hybris.platform.cockpit.services  
de.hybris.platform.cockpit.services.celum  
de.hybris.platform.cockpit.services.celum.impl  
de.hybris.platform.cockpit.services.comments  
de.hybris.platform.cockpit.services.comments.impl  
de.hybris.platform.cockpit.services.comments.modes  
de.hybris.platform.cockpit.services.comments.modes.impl  
de.hybris.platform.cockpit.services.config  
de.hybris.platform.cockpit.services.config.impl  
de.hybris.platform.cockpit.services.config.jaxb  
de.hybris.platform.cockpit.services.config.jaxb.advancedsearch  
de.hybris.platform.cockpit.services.config.jaxb.base  
de.hybris.platform.cockpit.services.config.jaxb.dashboard  
de.hybris.platform.cockpit.services.config.jaxb.editor  
de.hybris.platform.cockpit.services.config.jaxb.editor.preview  
de.hybris.platform.cockpit.services.config.jaxb.gridview  
de.hybris.platform.cockpit.services.config.jaxb.listview  
de.hybris.platform.cockpit.services.config.jaxb.wizard  
de.hybris.platform.cockpit.services.dragdrop  
de.hybris.platform.cockpit.services.dragdrop.impl  
de.hybris.platform.cockpit.services.exporter  
de.hybris.platform.cockpit.services.exporter.impl  
de.hybris.platform.cockpit.services.impl  
de.hybris.platform.cockpit.services.label  
de.hybris.platform.cockpit.services.label.impl  
de.hybris.platform.cockpit.services.login  
de.hybris.platform.cockpit.services.login.impl  
de.hybris.platform.cockpit.services.media  
de.hybris.platform.cockpit.services.media.impl  
de.hybris.platform.cockpit.services.meta  
de.hybris.platform.cockpit.services.meta.impl  
de.hybris.platform.cockpit.services.query  
de.hybris.platform.cockpit.services.query.daos  
de.hybris.platform.cockpit.services.query.daos.impl  
de.hybris.platform.cockpit.services.query.impl  
de.hybris.platform.cockpit.services.reports  
de.hybris.platform.cockpit.services.reports.impl  
de.hybris.platform.cockpit.services.search  
de.hybris.platform.cockpit.services.search.impl  
de.hybris.platform.cockpit.services.security  
de.hybris.platform.cockpit.services.security.impl  
de.hybris.platform.cockpit.services.sync  
de.hybris.platform.cockpit.services.sync.impl  
de.hybris.platform.cockpit.services.undo  
de.hybris.platform.cockpit.services.undo.impl  
de.hybris.platform.cockpit.services.validation  
de.hybris.platform.cockpit.services.validation.impl  
de.hybris.platform.cockpit.services.validation.pojos  
de.hybris.platform.cockpit.services.values  
de.hybris.platform.cockpit.services.values.impl  
de.hybris.platform.cockpit.services.xmlprovider  
de.hybris.platform.cockpit.services.xmlprovider.impl  
de.hybris.platform.cockpit.session  
de.hybris.platform.cockpit.session.impl  
de.hybris.platform.cockpit.systemsetup  
de.hybris.platform.cockpit.test  
de.hybris.platform.cockpit.test.mock  
de.hybris.platform.cockpit.translators  
de.hybris.platform.cockpit.util  
de.hybris.platform.cockpit.util.comparators  
de.hybris.platform.cockpit.util.jaxb  
de.hybris.platform.cockpit.util.jaxb.impl  
de.hybris.platform.cockpit.util.testing  
de.hybris.platform.cockpit.util.testing.impl  
de.hybris.platform.cockpit.widgets  
de.hybris.platform.cockpit.widgets.adapters  
de.hybris.platform.cockpit.widgets.adapters.impl  
de.hybris.platform.cockpit.widgets.browsers  
de.hybris.platform.cockpit.widgets.controllers  
de.hybris.platform.cockpit.widgets.controllers.impl  
de.hybris.platform.cockpit.widgets.events  
de.hybris.platform.cockpit.widgets.impl  
de.hybris.platform.cockpit.widgets.models  
de.hybris.platform.cockpit.widgets.models.impl  
de.hybris.platform.cockpit.widgets.portal  
de.hybris.platform.cockpit.widgets.portal.impl  
de.hybris.platform.cockpit.widgets.renderers  
de.hybris.platform.cockpit.widgets.util  
de.hybris.platform.cockpit.widgets.util.impl  
de.hybris.platform.cockpit.wizards  
de.hybris.platform.cockpit.wizards.comments  
de.hybris.platform.cockpit.wizards.exception  
de.hybris.platform.cockpit.wizards.generic  
de.hybris.platform.cockpit.wizards.generic.strategies  
de.hybris.platform.cockpit.wizards.impl  
de.hybris.platform.cockpit.wizards.listview  
de.hybris.platform.cockpit.wizards.media  
de.hybris.platform.cockpit.wizards.queries  
de.hybris.platform.cockpit.wizards.resetconfigs  
de.hybris.platform.cockpit.wizards.script  
de.hybris.platform.cockpit.wizards.workflow  
de.hybris.platform.cockpit.zk.mock  
de.hybris.platform.cockpit.zk.mock.test  
de.hybris.platform.comments  
de.hybris.platform.comments.constants  
de.hybris.platform.comments.daos  
de.hybris.platform.comments.interceptors  
de.hybris.platform.comments.jalo  
de.hybris.platform.comments.model
Contains generated models for each type of de.hybris.platform.comments.jalo package.
de.hybris.platform.comments.services  
de.hybris.platform.comments.services.impl  
de.hybris.platform.commercefacades  
de.hybris.platform.commercefacades.address  
de.hybris.platform.commercefacades.address.converters.populator  
de.hybris.platform.commercefacades.address.data  
de.hybris.platform.commercefacades.address.impl  
de.hybris.platform.commercefacades.basesite.data  
de.hybris.platform.commercefacades.basesites  
de.hybris.platform.commercefacades.basesites.converters.populator  
de.hybris.platform.commercefacades.basesites.impl  
de.hybris.platform.commercefacades.basestore.data  
de.hybris.platform.commercefacades.basestores  
de.hybris.platform.commercefacades.basestores.converters.populator  
de.hybris.platform.commercefacades.basestores.impl  
de.hybris.platform.commercefacades.catalog  
de.hybris.platform.commercefacades.catalog.converters.populator  
de.hybris.platform.commercefacades.catalog.converters.populators  
de.hybris.platform.commercefacades.catalog.data  
de.hybris.platform.commercefacades.catalog.impl  
de.hybris.platform.commercefacades.comment.converters.populator  
de.hybris.platform.commercefacades.comment.data  
de.hybris.platform.commercefacades.consent  
de.hybris.platform.commercefacades.consent.converters.populator  
de.hybris.platform.commercefacades.consent.data  
de.hybris.platform.commercefacades.consent.impl  
de.hybris.platform.commercefacades.constants  
de.hybris.platform.commercefacades.converter  
de.hybris.platform.commercefacades.converter.config  
de.hybris.platform.commercefacades.converter.impl  
de.hybris.platform.commercefacades.coupon  
de.hybris.platform.commercefacades.coupon.data  
de.hybris.platform.commercefacades.coupon.impl  
de.hybris.platform.commercefacades.customer  
de.hybris.platform.commercefacades.customer.impl  
de.hybris.platform.commercefacades.customergroups  
de.hybris.platform.commercefacades.customergroups.converters.populator  
de.hybris.platform.commercefacades.customergroups.exceptions  
de.hybris.platform.commercefacades.customergroups.impl  
de.hybris.platform.commercefacades.i18n  
de.hybris.platform.commercefacades.i18n.comparators  
de.hybris.platform.commercefacades.i18n.impl  
de.hybris.platform.commercefacades.order  
de.hybris.platform.commercefacades.order.converters.populator  
de.hybris.platform.commercefacades.order.data  
de.hybris.platform.commercefacades.order.impl  
de.hybris.platform.commercefacades.product  
de.hybris.platform.commercefacades.product.converters.populator  
de.hybris.platform.commercefacades.product.converters.populator.variantoptions  
de.hybris.platform.commercefacades.product.data  
de.hybris.platform.commercefacades.product.impl  
de.hybris.platform.commercefacades.product.strategies.merge  
de.hybris.platform.commercefacades.promotion  
de.hybris.platform.commercefacades.promotion.converters.populator  
de.hybris.platform.commercefacades.promotion.data  
de.hybris.platform.commercefacades.promotion.impl  
de.hybris.platform.commercefacades.quote.data  
de.hybris.platform.commercefacades.search  
de.hybris.platform.commercefacades.search.converters.populator  
de.hybris.platform.commercefacades.search.data  
de.hybris.platform.commercefacades.search.solrfacetsearch.converters.populator  
de.hybris.platform.commercefacades.search.solrfacetsearch.impl  
de.hybris.platform.commercefacades.spring  
de.hybris.platform.commercefacades.store.data  
de.hybris.platform.commercefacades.storefinder  
de.hybris.platform.commercefacades.storefinder.converters  
de.hybris.platform.commercefacades.storefinder.converters.populator  
de.hybris.platform.commercefacades.storefinder.data  
de.hybris.platform.commercefacades.storefinder.impl  
de.hybris.platform.commercefacades.storelocator  
de.hybris.platform.commercefacades.storelocator.converters.populator  
de.hybris.platform.commercefacades.storelocator.data  
de.hybris.platform.commercefacades.storelocator.helper.impl  
de.hybris.platform.commercefacades.storelocator.helpers  
de.hybris.platform.commercefacades.storelocator.helpers.impl  
de.hybris.platform.commercefacades.storelocator.impl  
de.hybris.platform.commercefacades.storesession  
de.hybris.platform.commercefacades.storesession.converters.populator  
de.hybris.platform.commercefacades.storesession.data  
de.hybris.platform.commercefacades.storesession.impl  
de.hybris.platform.commercefacades.url  
de.hybris.platform.commercefacades.url.impl  
de.hybris.platform.commercefacades.user  
de.hybris.platform.commercefacades.user.converters.populator  
de.hybris.platform.commercefacades.user.data  
de.hybris.platform.commercefacades.user.exceptions  
de.hybris.platform.commercefacades.user.impl  
de.hybris.platform.commercefacades.util  
de.hybris.platform.commercefacades.util.builder  
de.hybris.platform.commercefacades.voucher  
de.hybris.platform.commercefacades.voucher.converters.populator  
de.hybris.platform.commercefacades.voucher.data  
de.hybris.platform.commercefacades.voucher.exceptions  
de.hybris.platform.commercefacades.voucher.impl  
de.hybris.platform.commercefacades.xstream.alias  
de.hybris.platform.commercefacades.xstream.conv  
de.hybris.platform.commerceorgaddon  
de.hybris.platform.commerceorgaddon.breadcrumb.impl  
de.hybris.platform.commerceorgaddon.constants  
de.hybris.platform.commerceorgaddon.controllers  
de.hybris.platform.commerceorgaddon.controllers.pages  
de.hybris.platform.commerceorgaddon.forms  
de.hybris.platform.commerceorgaddon.forms.validation  
de.hybris.platform.commerceorgaddon.jalo  
de.hybris.platform.commerceorgsamplesaddon  
de.hybris.platform.commerceorgsamplesaddon.constants  
de.hybris.platform.commerceorgsamplesaddon.controllers  
de.hybris.platform.commerceorgsamplesaddon.jalo  
de.hybris.platform.commerceservices.actions.password  
de.hybris.platform.commerceservices.address  
de.hybris.platform.commerceservices.address.data  
de.hybris.platform.commerceservices.address.impl  
de.hybris.platform.commerceservices.address.util  
de.hybris.platform.commerceservices.attributeHandlers  
de.hybris.platform.commerceservices.backoffice  
de.hybris.platform.commerceservices.backoffice.actions.create  
de.hybris.platform.commerceservices.backoffice.constants  
de.hybris.platform.commerceservices.backoffice.controllers  
de.hybris.platform.commerceservices.backoffice.dropdownprovider  
de.hybris.platform.commerceservices.backoffice.editor  
de.hybris.platform.commerceservices.backoffice.jalo  
de.hybris.platform.commerceservices.backoffice.orgunits.actions  
de.hybris.platform.commerceservices.backoffice.widgets.organization.create.orgunit.employee  
de.hybris.platform.commerceservices.backoffice.widgets.organization.create.salesunit  
de.hybris.platform.commerceservices.backoffice.widgets.organization.util  
de.hybris.platform.commerceservices.backoffice.widgets.orgunits.search.initializer.sales  
de.hybris.platform.commerceservices.category  
de.hybris.platform.commerceservices.category.impl  
de.hybris.platform.commerceservices.comments  
de.hybris.platform.commerceservices.comments.builder  
de.hybris.platform.commerceservices.comments.impl  
de.hybris.platform.commerceservices.consent  
de.hybris.platform.commerceservices.consent.dao  
de.hybris.platform.commerceservices.consent.dao.impl  
de.hybris.platform.commerceservices.consent.exceptions  
de.hybris.platform.commerceservices.consent.impl  
de.hybris.platform.commerceservices.consent.interceptors  
de.hybris.platform.commerceservices.constants  
de.hybris.platform.commerceservices.customer  
de.hybris.platform.commerceservices.customer.dao  
de.hybris.platform.commerceservices.customer.dao.impl  
de.hybris.platform.commerceservices.customer.impl  
de.hybris.platform.commerceservices.customer.strategies  
de.hybris.platform.commerceservices.dataimport  
de.hybris.platform.commerceservices.dataimport.impl  
de.hybris.platform.commerceservices.delivery  
de.hybris.platform.commerceservices.delivery.dao  
de.hybris.platform.commerceservices.delivery.dao.impl  
de.hybris.platform.commerceservices.delivery.impl  
de.hybris.platform.commerceservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.commerceservices.event  
de.hybris.platform.commerceservices.externaltax  
de.hybris.platform.commerceservices.externaltax.impl  
de.hybris.platform.commerceservices.helper  
de.hybris.platform.commerceservices.i18n  
de.hybris.platform.commerceservices.i18n.impl  
de.hybris.platform.commerceservices.impersonation  
de.hybris.platform.commerceservices.impersonation.impl  
de.hybris.platform.commerceservices.impex.impl  
de.hybris.platform.commerceservices.jalo  
de.hybris.platform.commerceservices.jalo.consent  
de.hybris.platform.commerceservices.jalo.process  
de.hybris.platform.commerceservices.jalo.promotions  
de.hybris.platform.commerceservices.jalo.storelocator  
de.hybris.platform.commerceservices.jalo.user  
de.hybris.platform.commerceservices.model
Contains generated models for each type of de.hybris.platform.commerceservices.jalo package.
de.hybris.platform.commerceservices.model.consent
Contains generated models for each type of de.hybris.platform.commerceservices.jalo.consent package.
de.hybris.platform.commerceservices.model.process
Contains generated models for each type of de.hybris.platform.commerceservices.jalo.process package.
de.hybris.platform.commerceservices.model.promotions
Contains generated models for each type of de.hybris.platform.commerceservices.jalo.promotions package.
de.hybris.platform.commerceservices.model.storelocator
Contains generated models for each type of de.hybris.platform.commerceservices.jalo.storelocator package.
de.hybris.platform.commerceservices.model.user
Contains generated models for each type of de.hybris.platform.commerceservices.jalo.user package.
de.hybris.platform.commerceservices.order  
de.hybris.platform.commerceservices.order.dao  
de.hybris.platform.commerceservices.order.dao.impl  
de.hybris.platform.commerceservices.order.exceptions  
de.hybris.platform.commerceservices.order.hook  
de.hybris.platform.commerceservices.order.hook.impl  
de.hybris.platform.commerceservices.order.i18n  
de.hybris.platform.commerceservices.order.i18n.impl  
de.hybris.platform.commerceservices.order.impl  
de.hybris.platform.commerceservices.order.strategies  
de.hybris.platform.commerceservices.order.strategies.impl  
de.hybris.platform.commerceservices.order.validator  
de.hybris.platform.commerceservices.order.validator.impl  
de.hybris.platform.commerceservices.organization.cronjob  
de.hybris.platform.commerceservices.organization.daos  
de.hybris.platform.commerceservices.organization.daos.impl  
de.hybris.platform.commerceservices.organization.interceptor  
de.hybris.platform.commerceservices.organization.listeners.impl  
de.hybris.platform.commerceservices.organization.services  
de.hybris.platform.commerceservices.organization.services.impl  
de.hybris.platform.commerceservices.organization.strategies  
de.hybris.platform.commerceservices.organization.strategies.impl  
de.hybris.platform.commerceservices.organization.utils  
de.hybris.platform.commerceservices.price  
de.hybris.platform.commerceservices.price.impl  
de.hybris.platform.commerceservices.product  
de.hybris.platform.commerceservices.product.data  
de.hybris.platform.commerceservices.product.impl  
de.hybris.platform.commerceservices.promotion  
de.hybris.platform.commerceservices.promotion.dao  
de.hybris.platform.commerceservices.promotion.dao.impl  
de.hybris.platform.commerceservices.promotion.impl  
de.hybris.platform.commerceservices.request.mapping.annotation  
de.hybris.platform.commerceservices.retention.impl  
de.hybris.platform.commerceservices.search  
de.hybris.platform.commerceservices.search.dao  
de.hybris.platform.commerceservices.search.dao.impl  
de.hybris.platform.commerceservices.search.exceptions  
de.hybris.platform.commerceservices.search.facetdata  
de.hybris.platform.commerceservices.search.flexiblesearch  
de.hybris.platform.commerceservices.search.flexiblesearch.data  
de.hybris.platform.commerceservices.search.flexiblesearch.impl  
de.hybris.platform.commerceservices.search.impl  
de.hybris.platform.commerceservices.search.pagedata  
de.hybris.platform.commerceservices.search.resultdata  
de.hybris.platform.commerceservices.search.searchservices.dao  
de.hybris.platform.commerceservices.search.searchservices.dao.impl  
de.hybris.platform.commerceservices.search.searchservices.data  
de.hybris.platform.commerceservices.search.searchservices.impl  
de.hybris.platform.commerceservices.search.searchservices.populators  
de.hybris.platform.commerceservices.search.searchservices.provider.impl  
de.hybris.platform.commerceservices.search.searchservices.strategies  
de.hybris.platform.commerceservices.search.searchservices.strategies.impl  
de.hybris.platform.commerceservices.search.solrfacetsearch  
de.hybris.platform.commerceservices.search.solrfacetsearch.data  
de.hybris.platform.commerceservices.search.solrfacetsearch.impl  
de.hybris.platform.commerceservices.search.solrfacetsearch.indexer.listeners  
de.hybris.platform.commerceservices.search.solrfacetsearch.keywordredirect  
de.hybris.platform.commerceservices.search.solrfacetsearch.keywordredirect.impl  
de.hybris.platform.commerceservices.search.solrfacetsearch.populators  
de.hybris.platform.commerceservices.search.solrfacetsearch.provider  
de.hybris.platform.commerceservices.search.solrfacetsearch.provider.entity  
de.hybris.platform.commerceservices.search.solrfacetsearch.provider.impl  
de.hybris.platform.commerceservices.search.solrfacetsearch.querybuilder  
de.hybris.platform.commerceservices.search.solrfacetsearch.querybuilder.impl  
de.hybris.platform.commerceservices.search.solrfacetsearch.strategies  
de.hybris.platform.commerceservices.search.solrfacetsearch.strategies.exceptions  
de.hybris.platform.commerceservices.search.solrfacetsearch.strategies.impl  
de.hybris.platform.commerceservices.security  
de.hybris.platform.commerceservices.security.impl  
de.hybris.platform.commerceservices.service.data  
de.hybris.platform.commerceservices.setup  
de.hybris.platform.commerceservices.setup.data  
de.hybris.platform.commerceservices.setup.events  
de.hybris.platform.commerceservices.setup.impl  
de.hybris.platform.commerceservices.spring.config  
de.hybris.platform.commerceservices.spring.security  
de.hybris.platform.commerceservices.stock  
de.hybris.platform.commerceservices.stock.dao  
de.hybris.platform.commerceservices.stock.dao.impl  
de.hybris.platform.commerceservices.stock.impl  
de.hybris.platform.commerceservices.stock.strategies  
de.hybris.platform.commerceservices.stock.strategies.impl  
de.hybris.platform.commerceservices.store.data  
de.hybris.platform.commerceservices.storefinder  
de.hybris.platform.commerceservices.storefinder.data  
de.hybris.platform.commerceservices.storefinder.helpers  
de.hybris.platform.commerceservices.storefinder.helpers.impl  
de.hybris.platform.commerceservices.storefinder.impl  
de.hybris.platform.commerceservices.storesession  
de.hybris.platform.commerceservices.storesession.impl  
de.hybris.platform.commerceservices.strategies  
de.hybris.platform.commerceservices.strategies.hooks  
de.hybris.platform.commerceservices.strategies.impl  
de.hybris.platform.commerceservices.strategies.impl.user  
de.hybris.platform.commerceservices.threadcontext  
de.hybris.platform.commerceservices.threadcontext.impl  
de.hybris.platform.commerceservices.url  
de.hybris.platform.commerceservices.url.impl  
de.hybris.platform.commerceservices.user  
de.hybris.platform.commerceservices.user.impl  
de.hybris.platform.commerceservices.util  
de.hybris.platform.commerceservices.util.builder  
de.hybris.platform.commerceservices.validation  
de.hybris.platform.commercewebservices.core.auth  
de.hybris.platform.commercewebservices.core.auth.data  
de.hybris.platform.commercewebservices.core.basesite.data  
de.hybris.platform.commercewebservices.core.cart.hooks  
de.hybris.platform.commercewebservices.core.cart.impl  
de.hybris.platform.commercewebservices.core.consent.data  
de.hybris.platform.commercewebservices.core.constants  
de.hybris.platform.commercewebservices.core.context  
de.hybris.platform.commercewebservices.core.context.impl  
de.hybris.platform.commercewebservices.core.conv  
de.hybris.platform.commercewebservices.core.cronjob  
de.hybris.platform.commercewebservices.core.customer.populator  
de.hybris.platform.commercewebservices.core.errors.converters  
de.hybris.platform.commercewebservices.core.exceptions  
de.hybris.platform.commercewebservices.core.filter  
de.hybris.platform.commercewebservices.core.formatters  
de.hybris.platform.commercewebservices.core.formatters.impl  
de.hybris.platform.commercewebservices.core.mapping.converters  
de.hybris.platform.commercewebservices.core.mapping.mappers  
de.hybris.platform.commercewebservices.core.oauth2  
de.hybris.platform.commercewebservices.core.order.data  
de.hybris.platform.commercewebservices.core.populator  
de.hybris.platform.commercewebservices.core.populator.options  
de.hybris.platform.commercewebservices.core.product.data  
de.hybris.platform.commercewebservices.core.queues  
de.hybris.platform.commercewebservices.core.queues.channel  
de.hybris.platform.commercewebservices.core.queues.cronjob  
de.hybris.platform.commercewebservices.core.queues.data  
de.hybris.platform.commercewebservices.core.queues.impl  
de.hybris.platform.commercewebservices.core.queues.populators  
de.hybris.platform.commercewebservices.core.queues.util  
de.hybris.platform.commercewebservices.core.request.mapping.handler  
de.hybris.platform.commercewebservices.core.request.redirection  
de.hybris.platform.commercewebservices.core.request.support  
de.hybris.platform.commercewebservices.core.request.support.impl  
de.hybris.platform.commercewebservices.core.returns.data  
de.hybris.platform.commercewebservices.core.stock  
de.hybris.platform.commercewebservices.core.stock.impl  
de.hybris.platform.commercewebservices.core.store.data  
de.hybris.platform.commercewebservices.core.storesession.data  
de.hybris.platform.commercewebservices.core.strategies  
de.hybris.platform.commercewebservices.core.strategies.impl  
de.hybris.platform.commercewebservices.core.swagger  
de.hybris.platform.commercewebservices.core.user.data  
de.hybris.platform.commercewebservices.core.util.ws  
de.hybris.platform.commercewebservices.core.util.ws.impl  
de.hybris.platform.commercewebservices.core.v2.config  
de.hybris.platform.commercewebservices.core.v2.controller  
de.hybris.platform.commercewebservices.core.v2.filter  
de.hybris.platform.commercewebservices.core.v2.helper  
de.hybris.platform.commercewebservices.core.v2.swagger  
de.hybris.platform.commercewebservices.core.validation.data  
de.hybris.platform.commercewebservices.core.validator  
de.hybris.platform.commercewebservices.core.voucher.data  
de.hybris.platform.commercewebservices.core.xstream  
de.hybris.platform.commercewebservicescommons.annotation  
de.hybris.platform.commercewebservicescommons.cache  
de.hybris.platform.commercewebservicescommons.constants  
de.hybris.platform.commercewebservicescommons.dto.basesite  
de.hybris.platform.commercewebservicescommons.dto.basestore  
de.hybris.platform.commercewebservicescommons.dto.catalog  
de.hybris.platform.commercewebservicescommons.dto.comments  
de.hybris.platform.commercewebservicescommons.dto.consent  
de.hybris.platform.commercewebservicescommons.dto.order  
de.hybris.platform.commercewebservicescommons.dto.product  
de.hybris.platform.commercewebservicescommons.dto.queues  
de.hybris.platform.commercewebservicescommons.dto.quote  
de.hybris.platform.commercewebservicescommons.dto.search  
de.hybris.platform.commercewebservicescommons.dto.search.facetdata  
de.hybris.platform.commercewebservicescommons.dto.search.pagedata  
de.hybris.platform.commercewebservicescommons.dto.search.solrfacetsearch  
de.hybris.platform.commercewebservicescommons.dto.store  
de.hybris.platform.commercewebservicescommons.dto.storesession  
de.hybris.platform.commercewebservicescommons.dto.user  
de.hybris.platform.commercewebservicescommons.dto.voucher  
de.hybris.platform.commercewebservicescommons.errors.exceptions  
de.hybris.platform.commercewebservicescommons.jalo  
de.hybris.platform.commercewebservicescommons.jalo.expressupdate.cron  
de.hybris.platform.commercewebservicescommons.jalo.payment  
de.hybris.platform.commercewebservicescommons.model
Contains generated models for each type of de.hybris.platform.commercewebservicescommons.jalo package.
de.hybris.platform.commercewebservicescommons.model.expressupdate.cron
Contains generated models for each type of de.hybris.platform.commercewebservicescommons.jalo.expressupdate.cron package.
de.hybris.platform.commercewebservicescommons.model.payment
Contains generated models for each type of de.hybris.platform.commercewebservicescommons.jalo.payment package.
de.hybris.platform.commercewebservicescommons.strategies  
de.hybris.platform.commercewebservicescommons.strategies.impl  
de.hybris.platform.commercewebservicestests.constants  
de.hybris.platform.commercewebservicestests.jalo  
de.hybris.platform.commercewebservicestests.setup  
de.hybris.platform.commercewebservicestests.storelocator.impl  
de.hybris.platform.commercewebservicestests.test.groovy.webservicetests  
de.hybris.platform.commercewebservicestests.test.groovy.webservicetests.docu  
de.hybris.platform.commercewebservicestests.test.groovy.webservicetests.markers  
de.hybris.platform.commons.constants  
de.hybris.platform.commons.corrector  
de.hybris.platform.commons.corrector.strategy  
de.hybris.platform.commons.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.commons.jalo  
de.hybris.platform.commons.jalo.renderer  
de.hybris.platform.commons.jalo.translator  
de.hybris.platform.commons.model
Contains generated models for each type of de.hybris.platform.commons.jalo package.
de.hybris.platform.commons.model.renderer
Contains generated models for each type of de.hybris.platform.commons.jalo.renderer package.
de.hybris.platform.commons.model.translator
Contains generated models for each type of de.hybris.platform.commons.jalo.translator package.
de.hybris.platform.commons.renderer  
de.hybris.platform.commons.renderer.daos  
de.hybris.platform.commons.renderer.daos.impl  
de.hybris.platform.commons.renderer.exceptions  
de.hybris.platform.commons.renderer.impl  
de.hybris.platform.commons.renderer.model  
de.hybris.platform.commons.test.jalo  
de.hybris.platform.commons.translator  
de.hybris.platform.commons.translator.nodes  
de.hybris.platform.commons.translator.parsers  
de.hybris.platform.commons.translator.prerenderers  
de.hybris.platform.commons.translator.renderers  
de.hybris.platform.configurablebundleaddon.constants  
de.hybris.platform.configurablebundleaddon.controllers.cms  
de.hybris.platform.configurablebundleaddon.controllers.misc  
de.hybris.platform.configurablebundleaddon.controllers.pages  
de.hybris.platform.configurablebundleaddon.jalo  
de.hybris.platform.configurablebundlebackoffice.constants  
de.hybris.platform.configurablebundlebackoffice.labelproviders  
de.hybris.platform.configurablebundlebackoffice.renderers  
de.hybris.platform.configurablebundlebackoffice.synchronization.itemvisitors.impl  
de.hybris.platform.configurablebundlebackoffice.widgets.actions  
de.hybris.platform.configurablebundlebackoffice.widgets.common.dynamicforms  
de.hybris.platform.configurablebundlebackoffice.widgets.common.dynamicforms.impl  
de.hybris.platform.configurablebundlebackoffice.widgets.contextpopulator  
de.hybris.platform.configurablebundlebackoffice.widgets.editor.flattypehierarchyreferenceeditor  
de.hybris.platform.configurablebundlebackoffice.widgets.editor.flattypehierarchyreferenceeditor.model  
de.hybris.platform.configurablebundlebackoffice.widgets.editorarea.handlers  
de.hybris.platform.configurablebundlebackoffice.widgets.editorarea.renderer.impl  
de.hybris.platform.configurablebundlebackoffice.widgets.explorertree.refreshstrategy  
de.hybris.platform.configurablebundlebackoffice.widgets.explorertree.renderer  
de.hybris.platform.configurablebundlebackoffice.widgets.navigation  
de.hybris.platform.configurablebundlebackoffice.widgets.populator  
de.hybris.platform.configurablebundlebackoffice.widgets.searchadapters  
de.hybris.platform.configurablebundlecockpits.admincockpit.components.navigationarea  
de.hybris.platform.configurablebundlecockpits.admincockpit.services.security.data  
de.hybris.platform.configurablebundlecockpits.admincockpit.services.security.impl  
de.hybris.platform.configurablebundlecockpits.admincockpit.session.impl  
de.hybris.platform.configurablebundlecockpits.constants  
de.hybris.platform.configurablebundlecockpits.productcockpit.components.inspector.impl  
de.hybris.platform.configurablebundlecockpits.productcockpit.components.navigationarea.renderer  
de.hybris.platform.configurablebundlecockpits.productcockpit.model.listview.impl  
de.hybris.platform.configurablebundlecockpits.productcockpit.model.referenceeditor.simple.impl  
de.hybris.platform.configurablebundlecockpits.productcockpit.navigationnode.browserarea.list  
de.hybris.platform.configurablebundlecockpits.productcockpit.navigationnode.browserarea.tree  
de.hybris.platform.configurablebundlecockpits.productcockpit.session.impl  
de.hybris.platform.configurablebundlecockpits.productcockpit.session.impl.type  
de.hybris.platform.configurablebundlecockpits.servicelayer.services  
de.hybris.platform.configurablebundlecockpits.servicelayer.services.impl  
de.hybris.platform.configurablebundlecockpits.services.label.impl  
de.hybris.platform.configurablebundlecockpits.services.search.impl  
de.hybris.platform.configurablebundlecockpits.services.undo.impl  
de.hybris.platform.configurablebundlefacades  
de.hybris.platform.configurablebundlefacades.constants  
de.hybris.platform.configurablebundlefacades.converters  
de.hybris.platform.configurablebundlefacades.converters.populator  
de.hybris.platform.configurablebundlefacades.data  
de.hybris.platform.configurablebundlefacades.jalo  
de.hybris.platform.configurablebundlefacades.order  
de.hybris.platform.configurablebundlefacades.order.converters.comparator  
de.hybris.platform.configurablebundlefacades.order.converters.populator  
de.hybris.platform.configurablebundlefacades.order.impl  
de.hybris.platform.configurablebundleocc.constants  
de.hybris.platform.configurablebundleocc.controllers  
de.hybris.platform.configurablebundleocc.data  
de.hybris.platform.configurablebundleocc.dto  
de.hybris.platform.configurablebundleocctests  
de.hybris.platform.configurablebundleocctests.constants  
de.hybris.platform.configurablebundleocctests.setup  
de.hybris.platform.configurablebundleservices.bundle  
de.hybris.platform.configurablebundleservices.bundle.impl  
de.hybris.platform.configurablebundleservices.constants  
de.hybris.platform.configurablebundleservices.constraints  
de.hybris.platform.configurablebundleservices.daos  
de.hybris.platform.configurablebundleservices.daos.impl  
de.hybris.platform.configurablebundleservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.configurablebundleservices.interceptor.impl  
de.hybris.platform.configurablebundleservices.jalo  
de.hybris.platform.configurablebundleservices.jalo.components  
de.hybris.platform.configurablebundleservices.model
Contains generated models for each type of de.hybris.platform.configurablebundleservices.jalo package.
de.hybris.platform.configurablebundleservices.model.components
Contains generated models for each type of de.hybris.platform.configurablebundleservices.jalo.components package.
de.hybris.platform.configurablebundleservices.order  
de.hybris.platform.configurablebundleservices.order.hook  
de.hybris.platform.configurablebundleservices.order.impl  
de.hybris.platform.configurablebundleservices.search.solrfacetsearch.provider.impl  
de.hybris.platform.configurablebundleservices.setup  
de.hybris.platform.consignmenttrackingaddon.constants  
de.hybris.platform.consignmenttrackingaddon.controllers  
de.hybris.platform.consignmenttrackingaddon.controllers.pages.misc  
de.hybris.platform.consignmenttrackingaddon.decorator  
de.hybris.platform.consignmenttrackingaddon.jalo  
de.hybris.platform.consignmenttrackingaddon.model
Contains generated models for each type of de.hybris.platform.consignmenttrackingaddon.jalo package.
de.hybris.platform.consignmenttrackingbackoffice.constants  
de.hybris.platform.consignmenttrackingbackoffice.jalo  
de.hybris.platform.consignmenttrackingbackoffice.widgets  
de.hybris.platform.consignmenttrackingfacades  
de.hybris.platform.consignmenttrackingfacades.constants  
de.hybris.platform.consignmenttrackingfacades.delivery.data  
de.hybris.platform.consignmenttrackingfacades.impl  
de.hybris.platform.consignmenttrackingfacades.jalo  
de.hybris.platform.consignmenttrackingfacades.populators  
de.hybris.platform.consignmenttrackingmock.adaptors.impl  
de.hybris.platform.consignmenttrackingmock.constants  
de.hybris.platform.consignmenttrackingmock.data  
de.hybris.platform.consignmenttrackingmock.jalo  
de.hybris.platform.consignmenttrackingmock.service.impl  
de.hybris.platform.consignmenttrackingocc.constants  
de.hybris.platform.consignmenttrackingocc.controllers  
de.hybris.platform.consignmenttrackingocc.dto.consignmenttracking  
de.hybris.platform.consignmenttrackingocc.exceptions  
de.hybris.platform.consignmenttrackingocc.jalo  
de.hybris.platform.consignmenttrackingocc.validation  
de.hybris.platform.consignmenttrackingoccaddon.constants  
de.hybris.platform.consignmenttrackingoccaddon.controllers  
de.hybris.platform.consignmenttrackingoccaddon.dto.consignmenttracking  
de.hybris.platform.consignmenttrackingoccaddon.exceptions  
de.hybris.platform.consignmenttrackingoccaddon.jalo  
de.hybris.platform.consignmenttrackingoccaddon.validation  
de.hybris.platform.consignmenttrackingservices.adaptors  
de.hybris.platform.consignmenttrackingservices.constants  
de.hybris.platform.consignmenttrackingservices.daos  
de.hybris.platform.consignmenttrackingservices.daos.impl  
de.hybris.platform.consignmenttrackingservices.delivery.data  
de.hybris.platform.consignmenttrackingservices.interceptor  
de.hybris.platform.consignmenttrackingservices.jalo  
de.hybris.platform.consignmenttrackingservices.model
Contains generated models for each type of de.hybris.platform.consignmenttrackingservices.jalo package.
de.hybris.platform.consignmenttrackingservices.processor  
de.hybris.platform.consignmenttrackingservices.service  
de.hybris.platform.consignmenttrackingservices.service.impl  
de.hybris.platform.consignmenttrackingservices.validation.annotations  
de.hybris.platform.consignmenttrackingservices.validation.validators  
de.hybris.platform.constants  
de.hybris.platform.converters  
de.hybris.platform.converters.config  
de.hybris.platform.converters.data  
de.hybris.platform.converters.impl  
de.hybris.platform.core  
de.hybris.platform.core.audit  
de.hybris.platform.core.cors.constants  
de.hybris.platform.core.cors.converter  
de.hybris.platform.core.cors.exception  
de.hybris.platform.core.cors.loader  
de.hybris.platform.core.cors.loader.impl  
de.hybris.platform.core.cors.web  
de.hybris.platform.core.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.core.initialization  
de.hybris.platform.core.initialization.impl  
de.hybris.platform.core.initialization.testbeans  
de.hybris.platform.core.internal  
de.hybris.platform.core.locking  
de.hybris.platform.core.model
Contains generated models for each type of de.hybris.platform.jalo package.
de.hybris.platform.core.model.audit
Contains generated models for each type of de.hybris.platform.core.audit package.
de.hybris.platform.core.model.c2l
Contains generated models for each type of de.hybris.platform.jalo.c2l package.
de.hybris.platform.core.model.cors
Contains generated models for each type of de.hybris.platform.jalo.cors package.
de.hybris.platform.core.model.enumeration
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.core.model.flexiblesearch
Contains generated models for each type of de.hybris.platform.jalo.flexiblesearch package.
de.hybris.platform.core.model.initialization
Contains generated models for each type of de.hybris.platform.jalo.initialization package.
de.hybris.platform.core.model.link
Contains generated models for each type of de.hybris.platform.jalo.link package.
de.hybris.platform.core.model.media
Contains generated models for each type of de.hybris.platform.jalo.media package.
de.hybris.platform.core.model.order
Contains generated models for each type of de.hybris.platform.jalo.order package.
de.hybris.platform.core.model.order.delivery
Contains generated models for each type of de.hybris.platform.jalo.order.delivery package.
de.hybris.platform.core.model.order.payment
Contains generated models for each type of de.hybris.platform.jalo.order.payment package.
de.hybris.platform.core.model.order.price
Contains generated models for each type of de.hybris.platform.jalo.order.price package.
de.hybris.platform.core.model.product
Contains generated models for each type of de.hybris.platform.jalo.product package.
de.hybris.platform.core.model.security
Contains generated models for each type of de.hybris.platform.jalo.security package.
de.hybris.platform.core.model.test
Contains generated models for each type of de.hybris.platform.jalo.test package.
de.hybris.platform.core.model.type
Contains generated models for each type of de.hybris.platform.jalo.type package.
de.hybris.platform.core.model.user
Contains generated models for each type of de.hybris.platform.jalo.user package.
de.hybris.platform.core.model.util
Contains generated models for each type of de.hybris.platform.util package.
de.hybris.platform.core.model.web
Contains generated models for each type of de.hybris.platform.jalo.web package.
de.hybris.platform.core.order  
de.hybris.platform.core.servicelayer.data  
de.hybris.platform.core.ssl  
de.hybris.platform.core.suspend  
de.hybris.platform.core.system  
de.hybris.platform.core.system.impl  
de.hybris.platform.core.system.query  
de.hybris.platform.core.system.query.impl  
de.hybris.platform.core.systemsetup  
de.hybris.platform.core.systemsetup.datacreator.impl  
de.hybris.platform.core.systemsetup.datacreator.internal  
de.hybris.platform.core.threadregistry  
de.hybris.platform.coupon.backoffice.cockpitng.editor.coupons  
de.hybris.platform.coupon.backoffice.cockpitng.editor.defaultinseteditor  
de.hybris.platform.coupon.backoffice.cockpitng.editor.insets  
de.hybris.platform.coupon.backoffice.cockpitng.editor.tab  
de.hybris.platform.coupon.backoffice.cockpitng.editor.tab.populator  
de.hybris.platform.coupon.backoffice.data  
de.hybris.platform.couponbackoffice.constants  
de.hybris.platform.couponfacades  
de.hybris.platform.couponfacades.constants  
de.hybris.platform.couponfacades.converters.populator  
de.hybris.platform.couponfacades.facades.impl  
de.hybris.platform.couponservices  
de.hybris.platform.couponservices.action.impl  
de.hybris.platform.couponservices.cart.hooks  
de.hybris.platform.couponservices.conditions  
de.hybris.platform.couponservices.constants  
de.hybris.platform.couponservices.converters  
de.hybris.platform.couponservices.converters.populator  
de.hybris.platform.couponservices.couponcodegeneration  
de.hybris.platform.couponservices.couponcodegeneration.impl  
de.hybris.platform.couponservices.dao  
de.hybris.platform.couponservices.dao.impl  
de.hybris.platform.couponservices.interceptor  
de.hybris.platform.couponservices.jalo  
de.hybris.platform.couponservices.model
Contains generated models for each type of de.hybris.platform.couponservices.jalo package.
de.hybris.platform.couponservices.order.hooks  
de.hybris.platform.couponservices.rao  
de.hybris.platform.couponservices.rao.providers.impl  
de.hybris.platform.couponservices.redemption.strategies  
de.hybris.platform.couponservices.redemption.strategies.impl  
de.hybris.platform.couponservices.rule.evaluation.actions.impl  
de.hybris.platform.couponservices.rule.strategies.impl.mappers  
de.hybris.platform.couponservices.service.data  
de.hybris.platform.couponservices.services  
de.hybris.platform.couponservices.services.impl  
de.hybris.platform.couponservices.setup.impl  
de.hybris.platform.couponservices.strategies  
de.hybris.platform.couponservices.strategies.impl  
de.hybris.platform.couponservices.util  
de.hybris.platform.couponwebservices  
de.hybris.platform.couponwebservices.config  
de.hybris.platform.couponwebservices.constants  
de.hybris.platform.couponwebservices.controllers  
de.hybris.platform.couponwebservices.dto  
de.hybris.platform.couponwebservices.dto.ws  
de.hybris.platform.couponwebservices.facades  
de.hybris.platform.couponwebservices.facades.impl  
de.hybris.platform.couponwebservices.jaxb  
de.hybris.platform.couponwebservices.populators  
de.hybris.platform.couponwebservices.test.webservices  
de.hybris.platform.couponwebservices.util  
de.hybris.platform.couponwebservices.validator  
de.hybris.platform.cronjob  
de.hybris.platform.cronjob.constants  
de.hybris.platform.cronjob.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.cronjob.jalo  
de.hybris.platform.cronjob.mbeans  
de.hybris.platform.cronjob.mbeans.impl  
de.hybris.platform.cronjob.model
Contains generated models for each type of de.hybris.platform.cronjob.jalo package.
de.hybris.platform.cronjob.task  
de.hybris.platform.cronjob.util  
de.hybris.platform.customercouponaddon.breadcrumb  
de.hybris.platform.customercouponaddon.constants  
de.hybris.platform.customercouponaddon.controllers  
de.hybris.platform.customercouponaddon.controllers.misc  
de.hybris.platform.customercouponaddon.controllers.pages  
de.hybris.platform.customercouponaddon.jalo  
de.hybris.platform.customercouponbackoffice.constants  
de.hybris.platform.customercouponbackoffice.editors  
de.hybris.platform.customercouponbackoffice.jalo  
de.hybris.platform.customercouponbackoffice.renderers  
de.hybris.platform.customercouponbackoffice.widgets  
de.hybris.platform.customercouponfacades  
de.hybris.platform.customercouponfacades.constants  
de.hybris.platform.customercouponfacades.converter.populators  
de.hybris.platform.customercouponfacades.customercoupon.data  
de.hybris.platform.customercouponfacades.emums  
de.hybris.platform.customercouponfacades.hooks  
de.hybris.platform.customercouponfacades.hooks.impl  
de.hybris.platform.customercouponfacades.impl  
de.hybris.platform.customercouponfacades.jalo  
de.hybris.platform.customercouponfacades.process.email.context  
de.hybris.platform.customercouponfacades.strategies  
de.hybris.platform.customercouponfacades.strategies.impl  
de.hybris.platform.customercouponfacades.url.impl  
de.hybris.platform.customercouponocc.constants  
de.hybris.platform.customercouponocc.controllers  
de.hybris.platform.customercouponocc.controllers.customercoupon  
de.hybris.platform.customercouponocc.dto  
de.hybris.platform.customercouponocc.jalo  
de.hybris.platform.customercouponocc.validators  
de.hybris.platform.customercouponoccaddon.constants  
de.hybris.platform.customercouponoccaddon.controllers  
de.hybris.platform.customercouponoccaddon.controllers.customercoupon  
de.hybris.platform.customercouponoccaddon.dto  
de.hybris.platform.customercouponoccaddon.jalo  
de.hybris.platform.customercouponoccaddon.validators  
de.hybris.platform.customercouponsamplesaddon.constants  
de.hybris.platform.customercouponsamplesaddon.controllers  
de.hybris.platform.customercouponsamplesaddon.jalo  
de.hybris.platform.customercouponservices  
de.hybris.platform.customercouponservices.compiler.strategies.impl  
de.hybris.platform.customercouponservices.constants  
de.hybris.platform.customercouponservices.cronjob  
de.hybris.platform.customercouponservices.daos  
de.hybris.platform.customercouponservices.daos.impl  
de.hybris.platform.customercouponservices.email.process.impl  
de.hybris.platform.customercouponservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.customercouponservices.impl  
de.hybris.platform.customercouponservices.interceptor  
de.hybris.platform.customercouponservices.jalo  
de.hybris.platform.customercouponservices.model
Contains generated models for each type of de.hybris.platform.customercouponservices.jalo package.
de.hybris.platform.customercouponservices.order  
de.hybris.platform.customercouponservices.order.impl  
de.hybris.platform.customercouponservices.redemption.strategies.impl  
de.hybris.platform.customercouponservices.retention.hook  
de.hybris.platform.customercouponservices.sitemsg.process.impl  
de.hybris.platform.customercouponservices.sms.process.impl  
de.hybris.platform.customercouponservices.solrsearch  
de.hybris.platform.customercouponservices.strategies  
de.hybris.platform.customercouponservices.strategies.impl  
de.hybris.platform.customercouponservices.thread.factory  
de.hybris.platform.customerinterestsaddon.constants  
de.hybris.platform.customerinterestsaddon.controllers  
de.hybris.platform.customerinterestsaddon.controllers.pages  
de.hybris.platform.customerinterestsaddon.jalo  
de.hybris.platform.customerinterestsfacades.constants  
de.hybris.platform.customerinterestsfacades.data  
de.hybris.platform.customerinterestsfacades.futurestock  
de.hybris.platform.customerinterestsfacades.futurestock.impl  
de.hybris.platform.customerinterestsfacades.jalo  
de.hybris.platform.customerinterestsfacades.productinterest  
de.hybris.platform.customerinterestsfacades.productinterest.impl  
de.hybris.platform.customerinterestsfacades.productinterest.populators  
de.hybris.platform.customerinterestsfacades.productinterest.strageties.impl  
de.hybris.platform.customerinterestsfacades.strategies  
de.hybris.platform.customerinterestsfacades.strategies.impl  
de.hybris.platform.customerinterestsocc.constants  
de.hybris.platform.customerinterestsocc.controllers  
de.hybris.platform.customerinterestsocc.controllers.customerinterests  
de.hybris.platform.customerinterestsocc.dto  
de.hybris.platform.customerinterestsocc.jalo  
de.hybris.platform.customerinterestsocc.validation  
de.hybris.platform.customerinterestsoccaddon.constants  
de.hybris.platform.customerinterestsoccaddon.controllers  
de.hybris.platform.customerinterestsoccaddon.controllers.customerinterests  
de.hybris.platform.customerinterestsoccaddon.dto  
de.hybris.platform.customerinterestsoccaddon.jalo  
de.hybris.platform.customerinterestsoccaddon.validation  
de.hybris.platform.customerinterestsservices.constants  
de.hybris.platform.customerinterestsservices.hooks.impl  
de.hybris.platform.customerinterestsservices.jalo  
de.hybris.platform.customerinterestsservices.model
Contains generated models for each type of de.hybris.platform.customerinterestsservices.jalo package.
de.hybris.platform.customerinterestsservices.productinterest  
de.hybris.platform.customerinterestsservices.productinterest.cronjob  
de.hybris.platform.customerinterestsservices.productinterest.daos  
de.hybris.platform.customerinterestsservices.productinterest.daos.impl  
de.hybris.platform.customerinterestsservices.productinterest.impl  
de.hybris.platform.customerinterestsservices.productinterest.retention.hook  
de.hybris.platform.customerinterestsservices.retention.hook  
de.hybris.platform.customerreview  
de.hybris.platform.customerreview.constants  
de.hybris.platform.customerreview.dao  
de.hybris.platform.customerreview.dao.impl  
de.hybris.platform.customerreview.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.customerreview.impl  
de.hybris.platform.customerreview.jalo  
de.hybris.platform.customerreview.model
Contains generated models for each type of de.hybris.platform.customerreview.jalo package.
de.hybris.platform.customerreview.services  
de.hybris.platform.customerreview.setup  
de.hybris.platform.customersupport  
de.hybris.platform.customersupport.impl  
de.hybris.platform.customersupportbackoffice.accessors.impl  
de.hybris.platform.customersupportbackoffice.constants  
de.hybris.platform.customersupportbackoffice.data  
de.hybris.platform.customersupportbackoffice.dataaccess.facades.type  
de.hybris.platform.customersupportbackoffice.editor  
de.hybris.platform.customersupportbackoffice.editor.asm  
de.hybris.platform.customersupportbackoffice.editor.simpleselect  
de.hybris.platform.customersupportbackoffice.labelproviders  
de.hybris.platform.customersupportbackoffice.renderers  
de.hybris.platform.customersupportbackoffice.strategies  
de.hybris.platform.customersupportbackoffice.widgets  
de.hybris.platform.customersupportbackoffice.widgets.sessioncontext  
de.hybris.platform.customersupportbackoffice.widgets.sessioncontext.model  
de.hybris.platform.customersupportbackoffice.widgets.sessioncontext.util  
de.hybris.platform.customerticketingaddon.constants  
de.hybris.platform.customerticketingaddon.controllers  
de.hybris.platform.customerticketingaddon.controllers.pages  
de.hybris.platform.customerticketingaddon.forms  
de.hybris.platform.customerticketingaddon.jalo  
de.hybris.platform.customerticketingfacades  
de.hybris.platform.customerticketingfacades.constants  
de.hybris.platform.customerticketingfacades.converters.populators  
de.hybris.platform.customerticketingfacades.customerticket  
de.hybris.platform.customerticketingfacades.data  
de.hybris.platform.customerticketingfacades.jalo  
de.hybris.platform.customerticketingfacades.strategies  
de.hybris.platform.customerticketingocc.constants  
de.hybris.platform.customerticketingocc.controllers  
de.hybris.platform.customerticketingocc.converters  
de.hybris.platform.customerticketingocc.dto.ticket  
de.hybris.platform.customerticketingocc.errors.exceptions  
de.hybris.platform.customerticketingocc.jalo  
de.hybris.platform.customerticketingocc.validators  
de.hybris.platform.customerticketingocctests.constants  
de.hybris.platform.customerticketingocctests.jalo  
de.hybris.platform.customerticketingocctests.setup  
de.hybris.platform.datahubbackoffice  
de.hybris.platform.datahubbackoffice.constants  
de.hybris.platform.datahubbackoffice.daos  
de.hybris.platform.datahubbackoffice.daos.impl  
de.hybris.platform.datahubbackoffice.dataaccess  
de.hybris.platform.datahubbackoffice.dataaccess.composition  
de.hybris.platform.datahubbackoffice.dataaccess.composition.error  
de.hybris.platform.datahubbackoffice.dataaccess.dataloading  
de.hybris.platform.datahubbackoffice.dataaccess.feed  
de.hybris.platform.datahubbackoffice.dataaccess.metadata  
de.hybris.platform.datahubbackoffice.dataaccess.metadata.impl  
de.hybris.platform.datahubbackoffice.dataaccess.pool  
de.hybris.platform.datahubbackoffice.dataaccess.pool.history  
de.hybris.platform.datahubbackoffice.dataaccess.publication  
de.hybris.platform.datahubbackoffice.dataaccess.publication.error  
de.hybris.platform.datahubbackoffice.dataaccess.rawdata  
de.hybris.platform.datahubbackoffice.dataaccess.search  
de.hybris.platform.datahubbackoffice.dataaccess.search.strategy  
de.hybris.platform.datahubbackoffice.dataaccess.targetsystem  
de.hybris.platform.datahubbackoffice.datahub.controller  
de.hybris.platform.datahubbackoffice.datahub.dashboard  
de.hybris.platform.datahubbackoffice.datahub.rest  
de.hybris.platform.datahubbackoffice.dto.item  
de.hybris.platform.datahubbackoffice.exception  
de.hybris.platform.datahubbackoffice.jalo  
de.hybris.platform.datahubbackoffice.model
Contains generated models for each type of de.hybris.platform.datahubbackoffice.jalo package.
de.hybris.platform.datahubbackoffice.presentation.editor  
de.hybris.platform.datahubbackoffice.presentation.renderer  
de.hybris.platform.datahubbackoffice.presentation.widgets.compositionerrorsprovider  
de.hybris.platform.datahubbackoffice.presentation.widgets.dashboard  
de.hybris.platform.datahubbackoffice.presentation.widgets.datahubselector  
de.hybris.platform.datahubbackoffice.presentation.widgets.dataloadingfailuresprovider  
de.hybris.platform.datahubbackoffice.presentation.widgets.menuselectionadapter  
de.hybris.platform.datahubbackoffice.presentation.widgets.publicationerrorsprovider  
de.hybris.platform.datahubbackoffice.presentation.widgets.quickupload  
de.hybris.platform.datahubbackoffice.presentation.widgets.refresh  
de.hybris.platform.datahubbackoffice.presentation.widgets.relatedcanonicalitem  
de.hybris.platform.datahubbackoffice.service  
de.hybris.platform.datahubbackoffice.service.cockpitng  
de.hybris.platform.datahubbackoffice.service.cockpitng.fallback  
de.hybris.platform.datahubbackoffice.service.cockpitng.fallback.extender  
de.hybris.platform.datahubbackoffice.service.datahub  
de.hybris.platform.datahubbackoffice.service.datahub.impl  
de.hybris.platform.datahubclient.constants  
de.hybris.platform.dataimportcommons.constants  
de.hybris.platform.dataimportcommons.facades  
de.hybris.platform.dataimportcommons.facades.impl  
de.hybris.platform.dataimportcommons.facades.impl.converter  
de.hybris.platform.deeplink  
de.hybris.platform.deeplink.dao  
de.hybris.platform.deeplink.dao.impl  
de.hybris.platform.deeplink.jalo.media  
de.hybris.platform.deeplink.jalo.rules  
de.hybris.platform.deeplink.model.media
Contains generated models for each type of de.hybris.platform.deeplink.jalo.media package.
de.hybris.platform.deeplink.model.rules
Contains generated models for each type of de.hybris.platform.deeplink.jalo.rules package.
de.hybris.platform.deeplink.pojo  
de.hybris.platform.deeplink.resolvers  
de.hybris.platform.deeplink.resolvers.impl  
de.hybris.platform.deeplink.servicelayer.interceptors  
de.hybris.platform.deeplink.services  
de.hybris.platform.deeplink.services.impl  
de.hybris.platform.deeplink.web  
de.hybris.platform.deliveryzone  
de.hybris.platform.deliveryzone.constants  
de.hybris.platform.deliveryzone.jalo  
de.hybris.platform.deliveryzone.model
Contains generated models for each type of de.hybris.platform.deliveryzone.jalo package.
de.hybris.platform.directpersistence  
de.hybris.platform.directpersistence.annotation  
de.hybris.platform.directpersistence.audit  
de.hybris.platform.directpersistence.audit.dao  
de.hybris.platform.directpersistence.audit.dao.impl  
de.hybris.platform.directpersistence.audit.impl  
de.hybris.platform.directpersistence.audit.internal  
de.hybris.platform.directpersistence.cache  
de.hybris.platform.directpersistence.exception  
de.hybris.platform.directpersistence.impl  
de.hybris.platform.directpersistence.read  
de.hybris.platform.directpersistence.record  
de.hybris.platform.directpersistence.record.impl  
de.hybris.platform.directpersistence.record.visitor  
de.hybris.platform.directpersistence.selfhealing  
de.hybris.platform.directpersistence.selfhealing.impl  
de.hybris.platform.directpersistence.setter  
de.hybris.platform.directpersistence.statement  
de.hybris.platform.directpersistence.statement.backend  
de.hybris.platform.directpersistence.statement.sql  
de.hybris.platform.droolsruleengineservices.agendafilter  
de.hybris.platform.droolsruleengineservices.agendafilter.impl  
de.hybris.platform.droolsruleengineservices.aspect  
de.hybris.platform.droolsruleengineservices.compiler  
de.hybris.platform.droolsruleengineservices.compiler.impl  
de.hybris.platform.droolsruleengineservices.constants  
de.hybris.platform.droolsruleengineservices.eventlisteners  
de.hybris.platform.droolsruleengineservices.eventlisteners.impl  
de.hybris.platform.droolsruleengineservices.impl  
de.hybris.platform.droolsruleengineservices.interceptors  
de.hybris.platform.droolsruleengineservices.versioning.impl  
de.hybris.platform.dynamicattributes  
de.hybris.platform.dynamiccontent  
de.hybris.platform.dynamiccontent.impl  
de.hybris.platform.electronicsstore.constants  
de.hybris.platform.electronicsstore.jalo  
de.hybris.platform.electronicsstore.setup  
de.hybris.platform.embeddedserver  
de.hybris.platform.embeddedserver.api  
de.hybris.platform.embeddedserver.base  
de.hybris.platform.embeddedserver.constants  
de.hybris.platform.embeddedserver.jalo  
de.hybris.platform.embeddedserver.tomcat  
de.hybris.platform.embeddedserver.tomcat.constants  
de.hybris.platform.embeddedserver.tomcat.jalo  
de.hybris.platform.entitlementbackoffice.constants  
de.hybris.platform.entitlementbackoffice.jalo  
de.hybris.platform.entitlementfacades.constants  
de.hybris.platform.entitlementfacades.data  
de.hybris.platform.entitlementfacades.entitlement.populator  
de.hybris.platform.entitlementfacades.enums  
de.hybris.platform.entitlementfacades.integration  
de.hybris.platform.entitlementfacades.integration.templates  
de.hybris.platform.entitlementfacades.integration.templates.impl  
de.hybris.platform.entitlementfacades.jalo  
de.hybris.platform.entitlementfacades.product.converters.populator  
de.hybris.platform.entitlementservices  
de.hybris.platform.entitlementservices.constants  
de.hybris.platform.entitlementservices.daos  
de.hybris.platform.entitlementservices.daos.impl  
de.hybris.platform.entitlementservices.entitlement  
de.hybris.platform.entitlementservices.entitlement.impl  
de.hybris.platform.entitlementservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.entitlementservices.exception  
de.hybris.platform.entitlementservices.interceptor.impl  
de.hybris.platform.entitlementservices.jalo  
de.hybris.platform.entitlementservices.model
Contains generated models for each type of de.hybris.platform.entitlementservices.jalo package.
de.hybris.platform.entitlementservices.search.solrfacetsearch.provider.impl  
de.hybris.platform.enumeration  
de.hybris.platform.enumeration.impl  
de.hybris.platform.europe1  
de.hybris.platform.europe1.channel.strategies  
de.hybris.platform.europe1.channel.strategies.impl  
de.hybris.platform.europe1.constants  
de.hybris.platform.europe1.dynamic  
de.hybris.platform.europe1.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.europe1.jalo  
de.hybris.platform.europe1.jalo.impex  
de.hybris.platform.europe1.jalo.synchronization  
de.hybris.platform.europe1.model
Contains generated models for each type of de.hybris.platform.europe1.jalo package.
de.hybris.platform.europe1.persistence  
de.hybris.platform.externaltax  
de.hybris.platform.externaltax.dao  
de.hybris.platform.externaltax.impl  
de.hybris.platform.flexiblesearch  
de.hybris.platform.flexiblesearch.performance  
de.hybris.platform.fraud  
de.hybris.platform.fraud.constants  
de.hybris.platform.fraud.events  
de.hybris.platform.fraud.impl  
de.hybris.platform.fraud.impl.mock  
de.hybris.platform.fraud.jalo  
de.hybris.platform.fraud.model
Contains generated models for each type of de.hybris.platform.fraud.jalo package.
de.hybris.platform.fraud.strategy  
de.hybris.platform.fraud.symptom.impl  
de.hybris.platform.futurestock  
de.hybris.platform.genericsearch  
de.hybris.platform.genericsearch.impl  
de.hybris.platform.governor  
de.hybris.platform.gridfs  
de.hybris.platform.gridfs.constants  
de.hybris.platform.gridfs.jalo  
de.hybris.platform.gridfs.media.storage  
de.hybris.platform.groovynature  
de.hybris.platform.groovynature.constants  
de.hybris.platform.groovynature.jalo  
de.hybris.platform.hac  
de.hybris.platform.hac.constants  
de.hybris.platform.hac.controller  
de.hybris.platform.hac.controller.console  
de.hybris.platform.hac.controller.internal  
de.hybris.platform.hac.controller.monitoring  
de.hybris.platform.hac.controller.platform  
de.hybris.platform.hac.custom  
de.hybris.platform.hac.dao  
de.hybris.platform.hac.dao.impl  
de.hybris.platform.hac.data  
de.hybris.platform.hac.data.dto  
de.hybris.platform.hac.data.dto.cache.legacy  
de.hybris.platform.hac.data.dto.cache.region  
de.hybris.platform.hac.data.dto.cluster  
de.hybris.platform.hac.data.dto.monitoring  
de.hybris.platform.hac.data.form  
de.hybris.platform.hac.data.samplequery  
de.hybris.platform.hac.data.samplequery.impl  
de.hybris.platform.hac.data.validator  
de.hybris.platform.hac.editors  
de.hybris.platform.hac.exception  
de.hybris.platform.hac.facade  
de.hybris.platform.hac.facade.impl  
de.hybris.platform.hac.filter  
de.hybris.platform.hac.interceptors  
de.hybris.platform.hac.jalo  
de.hybris.platform.hac.localeresolver  
de.hybris.platform.hac.performance  
de.hybris.platform.hac.performance.impl  
de.hybris.platform.hac.request  
de.hybris.platform.hac.scripting  
de.hybris.platform.hac.scripting.exceptions  
de.hybris.platform.hac.scripting.impl  
de.hybris.platform.hac.session  
de.hybris.platform.hac.support  
de.hybris.platform.hac.taglib  
de.hybris.platform.hac.util  
de.hybris.platform.healthcheck  
de.hybris.platform.hmc.jalo  
de.hybris.platform.hmc.model
Contains generated models for each type of de.hybris.platform.hmc.jalo package.
de.hybris.platform.hybrisanalyticsaddon  
de.hybris.platform.hybrisanalyticsaddon.component.renderer  
de.hybris.platform.hybrisanalyticsaddon.constants  
de.hybris.platform.hybrisanalyticsaddon.controllers  
de.hybris.platform.hybrisanalyticsaddon.interceptors.beforeview  
de.hybris.platform.hybrisanalyticsaddon.jalo  
de.hybris.platform.hybrisanalyticsaddon.model
Contains generated models for each type of de.hybris.platform.hybrisanalyticsaddon.jalo package.
de.hybris.platform.impex  
de.hybris.platform.impex.constants  
de.hybris.platform.impex.distributed  
de.hybris.platform.impex.distributed.batch  
de.hybris.platform.impex.distributed.batch.impl  
de.hybris.platform.impex.distributed.log  
de.hybris.platform.impex.distributed.model  
de.hybris.platform.impex.distributed.process  
de.hybris.platform.impex.distributed.task  
de.hybris.platform.impex.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.impex.exceptions  
de.hybris.platform.impex.header.model  
de.hybris.platform.impex.header.model.impl  
de.hybris.platform.impex.internal  
de.hybris.platform.impex.jalo  
de.hybris.platform.impex.jalo.cronjob  
de.hybris.platform.impex.jalo.exp  
de.hybris.platform.impex.jalo.exp.converter  
de.hybris.platform.impex.jalo.exp.generator  
de.hybris.platform.impex.jalo.header  
de.hybris.platform.impex.jalo.imp  
de.hybris.platform.impex.jalo.media  
de.hybris.platform.impex.jalo.translators  
de.hybris.platform.impex.jalo.util  
de.hybris.platform.impex.jalo.xml  
de.hybris.platform.impex.model
Contains generated models for each type of de.hybris.platform.impex.jalo package.
de.hybris.platform.impex.model.cronjob
Contains generated models for each type of de.hybris.platform.impex.jalo.cronjob package.
de.hybris.platform.impex.model.exp
Contains generated models for each type of de.hybris.platform.impex.jalo.exp package.
de.hybris.platform.impex.session  
de.hybris.platform.impex.session.impl  
de.hybris.platform.impex.systemsetup  
de.hybris.platform.inboundservices.config  
de.hybris.platform.inboundservices.constants  
de.hybris.platform.inboundservices.exceptions  
de.hybris.platform.inboundservices.interceptor  
de.hybris.platform.inboundservices.jalo  
de.hybris.platform.inboundservices.model
Contains generated models for each type of de.hybris.platform.inboundservices.jalo package.
de.hybris.platform.inboundservices.persistence  
de.hybris.platform.inboundservices.persistence.impl  
de.hybris.platform.inboundservices.persistence.populator  
de.hybris.platform.inboundservices.persistence.validation  
de.hybris.platform.inboundservices.retention  
de.hybris.platform.inboundservices.strategies  
de.hybris.platform.inboundservices.strategies.impl  
de.hybris.platform.inboundservices.util  
de.hybris.platform.integration.cis.avs.constants  
de.hybris.platform.integration.cis.avs.populators  
de.hybris.platform.integration.cis.avs.services.impl  
de.hybris.platform.integration.cis.avs.strategies  
de.hybris.platform.integration.cis.avs.strategies.impl  
de.hybris.platform.integration.cis.payment.backoffice.actions  
de.hybris.platform.integration.cis.payment.commands  
de.hybris.platform.integration.cis.payment.constants  
de.hybris.platform.integration.cis.payment.converter  
de.hybris.platform.integration.cis.payment.cronjob  
de.hybris.platform.integration.cis.payment.impl  
de.hybris.platform.integration.cis.payment.jalo  
de.hybris.platform.integration.cis.payment.model
Contains generated models for each type of de.hybris.platform.integration.cis.payment.jalo package.
de.hybris.platform.integration.cis.payment.populators  
de.hybris.platform.integration.cis.payment.strategies.impl  
de.hybris.platform.integration.cis.subscription.constants  
de.hybris.platform.integration.cis.subscription.controllers.pages.payment  
de.hybris.platform.integration.cis.subscription.facades.impl  
de.hybris.platform.integration.cis.subscription.forms  
de.hybris.platform.integration.cis.subscription.jalo  
de.hybris.platform.integration.cis.subscription.populators  
de.hybris.platform.integration.cis.subscription.service  
de.hybris.platform.integration.cis.subscription.service.impl  
de.hybris.platform.integration.cis.subscription.util  
de.hybris.platform.integration.cis.tax  
de.hybris.platform.integration.cis.tax.constants  
de.hybris.platform.integration.cis.tax.populators  
de.hybris.platform.integration.cis.tax.service  
de.hybris.platform.integration.cis.tax.service.impl  
de.hybris.platform.integration.cis.tax.services.impl  
de.hybris.platform.integration.cis.tax.strategies  
de.hybris.platform.integration.cis.tax.strategies.impl  
de.hybris.platform.integration.cis.util  
de.hybris.platform.integration.commons  
de.hybris.platform.integration.commons.artifacts.jaxb  
de.hybris.platform.integration.commons.constants  
de.hybris.platform.integration.commons.daos  
de.hybris.platform.integration.commons.daos.impl  
de.hybris.platform.integration.commons.event  
de.hybris.platform.integration.commons.hystrix  
de.hybris.platform.integration.commons.jalo  
de.hybris.platform.integration.commons.model
Contains generated models for each type of de.hybris.platform.integration.commons.jalo package.
de.hybris.platform.integration.commons.services  
de.hybris.platform.integration.commons.services.impl  
de.hybris.platform.integration.commons.strategies  
de.hybris.platform.integration.commons.strategies.impl  
de.hybris.platform.integration.commons.util  
de.hybris.platform.integration.monitoring.backoffice  
de.hybris.platform.integration.monitoring.backoffice.constants  
de.hybris.platform.integration.monitoring.backoffice.jalo  
de.hybris.platform.integration.monitoring.backoffice.services  
de.hybris.platform.integration.ondemand.sampledata.constants  
de.hybris.platform.integration.ondemand.sampledata.event  
de.hybris.platform.integration.ondemand.sampledata.jalo  
de.hybris.platform.integrationbackoffice  
de.hybris.platform.integrationbackoffice.config  
de.hybris.platform.integrationbackoffice.constants  
de.hybris.platform.integrationbackoffice.dto  
de.hybris.platform.integrationbackoffice.exceptionhandlers  
de.hybris.platform.integrationbackoffice.exceptions  
de.hybris.platform.integrationbackoffice.jalo  
de.hybris.platform.integrationbackoffice.rules  
de.hybris.platform.integrationbackoffice.services  
de.hybris.platform.integrationbackoffice.services.impl  
de.hybris.platform.integrationbackoffice.utility  
de.hybris.platform.integrationbackoffice.widgets.authentication  
de.hybris.platform.integrationbackoffice.widgets.authentication.actions  
de.hybris.platform.integrationbackoffice.widgets.authentication.handlers  
de.hybris.platform.integrationbackoffice.widgets.authentication.registration  
de.hybris.platform.integrationbackoffice.widgets.authentication.utility.impl  
de.hybris.platform.integrationbackoffice.widgets.authorization.controllers  
de.hybris.platform.integrationbackoffice.widgets.authorization.utility  
de.hybris.platform.integrationbackoffice.widgets.common.controllers  
de.hybris.platform.integrationbackoffice.widgets.common.data  
de.hybris.platform.integrationbackoffice.widgets.common.services  
de.hybris.platform.integrationbackoffice.widgets.common.services.impl  
de.hybris.platform.integrationbackoffice.widgets.common.utility  
de.hybris.platform.integrationbackoffice.widgets.configuration.actions  
de.hybris.platform.integrationbackoffice.widgets.configuration.controllers  
de.hybris.platform.integrationbackoffice.widgets.configuration.data  
de.hybris.platform.integrationbackoffice.widgets.configuration.generators  
de.hybris.platform.integrationbackoffice.widgets.configuration.utility  
de.hybris.platform.integrationbackoffice.widgets.modals.builders  
de.hybris.platform.integrationbackoffice.widgets.modals.controllers  
de.hybris.platform.integrationbackoffice.widgets.modals.data  
de.hybris.platform.integrationbackoffice.widgets.modals.data.itemtypematchmodal  
de.hybris.platform.integrationbackoffice.widgets.modals.data.visualizer  
de.hybris.platform.integrationbackoffice.widgets.modals.generator  
de.hybris.platform.integrationbackoffice.widgets.modals.utility  
de.hybris.platform.integrationbackoffice.widgets.modeling.actions  
de.hybris.platform.integrationbackoffice.widgets.modeling.builders  
de.hybris.platform.integrationbackoffice.widgets.modeling.controllers  
de.hybris.platform.integrationbackoffice.widgets.modeling.data  
de.hybris.platform.integrationbackoffice.widgets.modeling.handlers  
de.hybris.platform.integrationbackoffice.widgets.modeling.providers  
de.hybris.platform.integrationbackoffice.widgets.modeling.utility  
de.hybris.platform.integrationservices  
de.hybris.platform.integrationservices.asserts  
de.hybris.platform.integrationservices.cache  
de.hybris.platform.integrationservices.cache.impl  
de.hybris.platform.integrationservices.config  
de.hybris.platform.integrationservices.constants  
de.hybris.platform.integrationservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.integrationservices.exception  
de.hybris.platform.integrationservices.integrationkey  
de.hybris.platform.integrationservices.integrationkey.impl  
de.hybris.platform.integrationservices.interceptor  
de.hybris.platform.integrationservices.interceptor.interfaces  
de.hybris.platform.integrationservices.item  
de.hybris.platform.integrationservices.jalo  
de.hybris.platform.integrationservices.model
Contains generated models for each type of de.hybris.platform.integrationservices.jalo package.
de.hybris.platform.integrationservices.model.impl  
de.hybris.platform.integrationservices.monitoring  
de.hybris.platform.integrationservices.passport  
de.hybris.platform.integrationservices.populator  
de.hybris.platform.integrationservices.retention  
de.hybris.platform.integrationservices.scripting  
de.hybris.platform.integrationservices.search  
de.hybris.platform.integrationservices.search.enricher  
de.hybris.platform.integrationservices.search.impl  
de.hybris.platform.integrationservices.search.validation  
de.hybris.platform.integrationservices.security  
de.hybris.platform.integrationservices.security.impl  
de.hybris.platform.integrationservices.service  
de.hybris.platform.integrationservices.service.impl  
de.hybris.platform.integrationservices.update  
de.hybris.platform.integrationservices.util  
de.hybris.platform.integrationservices.util.featuretoggle  
de.hybris.platform.integrationservices.util.impex  
de.hybris.platform.integrationservices.util.lifecycle  
de.hybris.platform.integrationservices.util.timeout  
de.hybris.platform.integrationservices.util.timeout.impl  
de.hybris.platform.integrationservices.validator  
de.hybris.platform.integrationservices.virtualattributes  
de.hybris.platform.integrationservices.virtualattributes.impl  
de.hybris.platform.jalo  
de.hybris.platform.jalo.c2l  
de.hybris.platform.jalo.config  
de.hybris.platform.jalo.cors  
de.hybris.platform.jalo.enumeration  
de.hybris.platform.jalo.extension  
de.hybris.platform.jalo.flexiblesearch  
de.hybris.platform.jalo.flexiblesearch.hints  
de.hybris.platform.jalo.flexiblesearch.hints.impl  
de.hybris.platform.jalo.flexiblesearch.internal  
de.hybris.platform.jalo.flexiblesearch.limit  
de.hybris.platform.jalo.flexiblesearch.limit.impl  
de.hybris.platform.jalo.initialization  
de.hybris.platform.jalo.link  
de.hybris.platform.jalo.media  
de.hybris.platform.jalo.meta  
de.hybris.platform.jalo.numberseries  
de.hybris.platform.jalo.order  
de.hybris.platform.jalo.order.delivery  
de.hybris.platform.jalo.order.payment  
de.hybris.platform.jalo.order.price  
de.hybris.platform.jalo.product  
de.hybris.platform.jalo.security  
de.hybris.platform.jalo.security.event  
de.hybris.platform.jalo.test  
de.hybris.platform.jalo.type  
de.hybris.platform.jalo.user  
de.hybris.platform.jalo.web  
de.hybris.platform.jdbcwrapper  
de.hybris.platform.jdbcwrapper.interceptor  
de.hybris.platform.jdbcwrapper.interceptor.factory  
de.hybris.platform.jdbcwrapper.interceptor.recover  
de.hybris.platform.jdbcwrapper.logger  
de.hybris.platform.jmx  
de.hybris.platform.jmx.mbeans  
de.hybris.platform.jmx.mbeans.impl  
de.hybris.platform.jobs  
de.hybris.platform.jobs.maintenance  
de.hybris.platform.jobs.maintenance.impl  
de.hybris.platform.kymaintegrationbackoffice.actions  
de.hybris.platform.kymaintegrationbackoffice.constants  
de.hybris.platform.kymaintegrationbackoffice.widgets  
de.hybris.platform.kymaintegrationservices.constants  
de.hybris.platform.kymaintegrationservices.dto  
de.hybris.platform.kymaintegrationservices.event  
de.hybris.platform.kymaintegrationservices.event.impl  
de.hybris.platform.kymaintegrationservices.event.listeners  
de.hybris.platform.kymaintegrationservices.exceptions  
de.hybris.platform.kymaintegrationservices.interceptors  
de.hybris.platform.kymaintegrationservices.jalo  
de.hybris.platform.kymaintegrationservices.jobs  
de.hybris.platform.kymaintegrationservices.populators  
de.hybris.platform.kymaintegrationservices.populators.custom  
de.hybris.platform.kymaintegrationservices.services  
de.hybris.platform.kymaintegrationservices.services.impl  
de.hybris.platform.kymaintegrationservices.strategies.impl  
de.hybris.platform.kymaintegrationservices.task  
de.hybris.platform.kymaintegrationservices.utils  
de.hybris.platform.ldap  
de.hybris.platform.ldap.connection  
de.hybris.platform.ldap.connection.ssl  
de.hybris.platform.ldap.constants  
de.hybris.platform.ldap.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.ldap.exception  
de.hybris.platform.ldap.impex  
de.hybris.platform.ldap.jalo  
de.hybris.platform.ldap.jalo.configuration  
de.hybris.platform.ldap.jalo.configuration.taglistener  
de.hybris.platform.ldap.jalo.configuration.valueobject  
de.hybris.platform.ldap.jalo.impl  
de.hybris.platform.ldap.jalo.security.user  
de.hybris.platform.ldap.jobs  
de.hybris.platform.ldap.jobs.impl  
de.hybris.platform.ldap.log  
de.hybris.platform.ldap.model
Contains generated models for each type of de.hybris.platform.ldap.jalo package.
de.hybris.platform.ldap.services.impl  
de.hybris.platform.ldap.util  
de.hybris.platform.licence  
de.hybris.platform.licence.internal  
de.hybris.platform.licence.sap  
de.hybris.platform.maintenance  
de.hybris.platform.marketplaceaddon.breadcrumb  
de.hybris.platform.marketplaceaddon.constants  
de.hybris.platform.marketplaceaddon.controllers  
de.hybris.platform.marketplaceaddon.controllers.cms  
de.hybris.platform.marketplaceaddon.controllers.pages  
de.hybris.platform.marketplaceaddon.decorator  
de.hybris.platform.marketplaceaddon.forms  
de.hybris.platform.marketplaceaddon.forms.validation  
de.hybris.platform.marketplaceaddon.jalo  
de.hybris.platform.marketplaceaddon.model
Contains generated models for each type of de.hybris.platform.marketplaceaddon.jalo package.
de.hybris.platform.marketplaceaddon.renderer.impl  
de.hybris.platform.marketplaceaddon.setup  
de.hybris.platform.marketplacebackoffice.actions  
de.hybris.platform.marketplacebackoffice.constants  
de.hybris.platform.marketplacebackoffice.customization  
de.hybris.platform.marketplacebackoffice.data  
de.hybris.platform.marketplacebackoffice.exceptions  
de.hybris.platform.marketplacebackoffice.jalo  
de.hybris.platform.marketplacebackoffice.renderes  
de.hybris.platform.marketplacebackoffice.utils  
de.hybris.platform.marketplacebackoffice.widgets  
de.hybris.platform.marketplacebackofficesamplesaddon.constants  
de.hybris.platform.marketplacebackofficesamplesaddon.jalo  
de.hybris.platform.marketplacefacades  
de.hybris.platform.marketplacefacades.cart.converters.populator  
de.hybris.platform.marketplacefacades.consignment.converters.populators  
de.hybris.platform.marketplacefacades.constants  
de.hybris.platform.marketplacefacades.impl  
de.hybris.platform.marketplacefacades.jalo  
de.hybris.platform.marketplacefacades.product.converters.populator  
de.hybris.platform.marketplacefacades.search.converters.populators  
de.hybris.platform.marketplacefacades.vendor  
de.hybris.platform.marketplacefacades.vendor.converters.populator  
de.hybris.platform.marketplacefacades.vendor.data  
de.hybris.platform.marketplacefacades.vendor.impl  
de.hybris.platform.marketplaceocc.constants  
de.hybris.platform.marketplaceocc.controllers  
de.hybris.platform.marketplaceocc.controllers.hotfolder  
de.hybris.platform.marketplaceocc.exceptions  
de.hybris.platform.marketplaceocc.filters  
de.hybris.platform.marketplaceocc.helper  
de.hybris.platform.marketplaceocc.hotfolder.dto  
de.hybris.platform.marketplaceocc.jalo  
de.hybris.platform.marketplaceoccaddon.constants  
de.hybris.platform.marketplaceoccaddon.controllers  
de.hybris.platform.marketplaceoccaddon.controllers.hotfolder  
de.hybris.platform.marketplaceoccaddon.exceptions  
de.hybris.platform.marketplaceoccaddon.filters  
de.hybris.platform.marketplaceoccaddon.helper  
de.hybris.platform.marketplaceoccaddon.jalo  
de.hybris.platform.marketplaceoccaddon.setup  
de.hybris.platform.marketplacepromotionenginesamplesaddon.constants  
de.hybris.platform.marketplacepromotionenginesamplesaddon.jalo  
de.hybris.platform.marketplaceservices.catalog.impl  
de.hybris.platform.marketplaceservices.constants  
de.hybris.platform.marketplaceservices.cronjob  
de.hybris.platform.marketplaceservices.dao  
de.hybris.platform.marketplaceservices.dao.impl  
de.hybris.platform.marketplaceservices.data  
de.hybris.platform.marketplaceservices.data.impl  
de.hybris.platform.marketplaceservices.dataimport.batch  
de.hybris.platform.marketplaceservices.dataimport.batch.task  
de.hybris.platform.marketplaceservices.dataimport.batch.translator  
de.hybris.platform.marketplaceservices.dataimport.batch.util  
de.hybris.platform.marketplaceservices.evaluator.impl  
de.hybris.platform.marketplaceservices.interceptor  
de.hybris.platform.marketplaceservices.jalo  
de.hybris.platform.marketplaceservices.jalo.restrictions  
de.hybris.platform.marketplaceservices.model
Contains generated models for each type of de.hybris.platform.marketplaceservices.jalo package.
de.hybris.platform.marketplaceservices.model.restrictions
Contains generated models for each type of de.hybris.platform.marketplaceservices.jalo.restrictions package.
de.hybris.platform.marketplaceservices.product  
de.hybris.platform.marketplaceservices.product.impl  
de.hybris.platform.marketplaceservices.retention.hook  
de.hybris.platform.marketplaceservices.retention.hooks.impl  
de.hybris.platform.marketplaceservices.setup  
de.hybris.platform.marketplaceservices.solr.provider  
de.hybris.platform.marketplaceservices.solr.resolver  
de.hybris.platform.marketplaceservices.strategies  
de.hybris.platform.marketplaceservices.strategies.hooks  
de.hybris.platform.marketplaceservices.strategies.hooks.impl  
de.hybris.platform.marketplaceservices.strategies.impl  
de.hybris.platform.marketplaceservices.url.impl  
de.hybris.platform.marketplaceservices.vendor  
de.hybris.platform.marketplaceservices.vendor.daos  
de.hybris.platform.marketplaceservices.vendor.daos.impl  
de.hybris.platform.marketplaceservices.vendor.impl  
de.hybris.platform.marketplacestore.constants  
de.hybris.platform.marketplacestore.jalo  
de.hybris.platform.marketplacestore.service.dataimport.impl  
de.hybris.platform.marketplacestore.setup  
de.hybris.platform.marketplacewebservices.hotfolder.dto  
de.hybris.platform.masterserver  
de.hybris.platform.masterserver.collector.business.impl  
de.hybris.platform.masterserver.collector.system.impl  
de.hybris.platform.masterserver.collector.system.impl.spring  
de.hybris.platform.masterserver.impl  
de.hybris.platform.media  
de.hybris.platform.media.exceptions  
de.hybris.platform.media.impl  
de.hybris.platform.media.interceptors  
de.hybris.platform.media.services  
de.hybris.platform.media.services.impl  
de.hybris.platform.media.storage  
de.hybris.platform.media.storage.impl  
de.hybris.platform.media.url  
de.hybris.platform.media.url.impl  
de.hybris.platform.media.web  
de.hybris.platform.mediaconversion  
de.hybris.platform.mediaconversion.constants  
de.hybris.platform.mediaconversion.conversion  
de.hybris.platform.mediaconversion.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.mediaconversion.imagemagick  
de.hybris.platform.mediaconversion.integrationtest  
de.hybris.platform.mediaconversion.jalo  
de.hybris.platform.mediaconversion.jalo.job  
de.hybris.platform.mediaconversion.job  
de.hybris.platform.mediaconversion.metadata  
de.hybris.platform.mediaconversion.metadata.image  
de.hybris.platform.mediaconversion.mock  
de.hybris.platform.mediaconversion.model
Contains generated models for each type of de.hybris.platform.mediaconversion.jalo package.
de.hybris.platform.mediaconversion.model.attributes  
de.hybris.platform.mediaconversion.model.interceptors  
de.hybris.platform.mediaconversion.model.job
Contains generated models for each type of de.hybris.platform.mediaconversion.jalo.job package.
de.hybris.platform.mediaconversion.os  
de.hybris.platform.mediaconversion.os.config  
de.hybris.platform.mediaconversion.os.process  
de.hybris.platform.mediaconversion.os.process.factory  
de.hybris.platform.mediaconversion.os.process.impl  
de.hybris.platform.mediaconversion.os.process.rmi  
de.hybris.platform.mediaconversion.setup  
de.hybris.platform.mediaconversion.util  
de.hybris.platform.mediaconversion.web.facades  
de.hybris.platform.mediaconversion.web.servlet  
de.hybris.platform.mediaconversion.web.tag  
de.hybris.platform.mediaconversionbackoffice  
de.hybris.platform.mediaconversionbackoffice.constants  
de.hybris.platform.mediaconversionbackoffice.editors.converdeletemedias  
de.hybris.platform.mediaconversionbackoffice.editors.extractdeletemetadata.media  
de.hybris.platform.mediaconversionbackoffice.editors.extractdeletemetadata.mediacontainer  
de.hybris.platform.mediaconversionbackoffice.jalo  
de.hybris.platform.mediaweb  
de.hybris.platform.mediaweb.assertions.assertj  
de.hybris.platform.mediaweb.constants  
de.hybris.platform.mediaweb.jalo  
de.hybris.platform.merchandisingservicesbackoffice.constants  
de.hybris.platform.merchandisingservicesbackoffice.editor  
de.hybris.platform.merchandisingservicesbackoffice.editor.facade  
de.hybris.platform.merchandisingsmartedit  
de.hybris.platform.messagecentercsfacades  
de.hybris.platform.messagecentercsfacades.constants  
de.hybris.platform.messagecentercsfacades.data  
de.hybris.platform.messagecentercsfacades.impl  
de.hybris.platform.messagecentercsfacades.jalo  
de.hybris.platform.messagecentercsfacades.populators  
de.hybris.platform.messagecentercsfacades.util  
de.hybris.platform.messagecentercsocc.constants  
de.hybris.platform.messagecentercsocc.controllers  
de.hybris.platform.messagecentercsocc.controllers.messagecenter  
de.hybris.platform.messagecentercsocc.dto.conversation  
de.hybris.platform.messagecentercsocc.exceptions  
de.hybris.platform.messagecentercsocc.filters  
de.hybris.platform.messagecentercsocc.jalo  
de.hybris.platform.messagecentercsocc.validation  
de.hybris.platform.messagecentercsoccaddon.constants  
de.hybris.platform.messagecentercsoccaddon.controllers  
de.hybris.platform.messagecentercsoccaddon.controllers.messagecenter  
de.hybris.platform.messagecentercsoccaddon.dto.conversation  
de.hybris.platform.messagecentercsoccaddon.exceptions  
de.hybris.platform.messagecentercsoccaddon.filters  
de.hybris.platform.messagecentercsoccaddon.jalo  
de.hybris.platform.messagecentercsoccaddon.setup  
de.hybris.platform.messagecentercsoccaddon.validation  
de.hybris.platform.messagecentercsservices  
de.hybris.platform.messagecentercsservices.constants  
de.hybris.platform.messagecentercsservices.daos  
de.hybris.platform.messagecentercsservices.daos.impl  
de.hybris.platform.messagecentercsservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.messagecentercsservices.impl  
de.hybris.platform.messagecentercsservices.jalo  
de.hybris.platform.messagecentercsservices.model
Contains generated models for each type of de.hybris.platform.messagecentercsservices.jalo package.
de.hybris.platform.metrics  
de.hybris.platform.metrics.dropwizard  
de.hybris.platform.misc  
de.hybris.platform.multicountrysampledataaddon  
de.hybris.platform.multicountrysampledataaddon.constants  
de.hybris.platform.multicountrysampledataaddon.jalo  
de.hybris.platform.multicountrysampledataaddon.setup.impl  
de.hybris.platform.notificationaddon.constants  
de.hybris.platform.notificationaddon.controllers  
de.hybris.platform.notificationaddon.controllers.pages  
de.hybris.platform.notificationaddon.forms  
de.hybris.platform.notificationaddon.jalo  
de.hybris.platform.notificationfacades.constants  
de.hybris.platform.notificationfacades.data  
de.hybris.platform.notificationfacades.facades  
de.hybris.platform.notificationfacades.facades.impl  
de.hybris.platform.notificationfacades.jalo  
de.hybris.platform.notificationfacades.populators  
de.hybris.platform.notificationfacades.url  
de.hybris.platform.notificationocc.constants  
de.hybris.platform.notificationocc.controllers  
de.hybris.platform.notificationocc.dto  
de.hybris.platform.notificationocc.dto.conversation  
de.hybris.platform.notificationocc.jalo  
de.hybris.platform.notificationocc.mapping.converters  
de.hybris.platform.notificationocc.validator  
de.hybris.platform.notificationoccaddon.constants  
de.hybris.platform.notificationoccaddon.controllers  
de.hybris.platform.notificationoccaddon.dto  
de.hybris.platform.notificationoccaddon.dto.conversation  
de.hybris.platform.notificationoccaddon.jalo  
de.hybris.platform.notificationoccaddon.mapping.converters  
de.hybris.platform.notificationoccaddon.validator  
de.hybris.platform.notificationservices.constants  
de.hybris.platform.notificationservices.cronjob  
de.hybris.platform.notificationservices.dao  
de.hybris.platform.notificationservices.dao.impl  
de.hybris.platform.notificationservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.notificationservices.formatters  
de.hybris.platform.notificationservices.formatters.impl  
de.hybris.platform.notificationservices.jalo  
de.hybris.platform.notificationservices.mapping  
de.hybris.platform.notificationservices.model
Contains generated models for each type of de.hybris.platform.notificationservices.jalo package.
de.hybris.platform.notificationservices.processor  
de.hybris.platform.notificationservices.retention.hook  
de.hybris.platform.notificationservices.service  
de.hybris.platform.notificationservices.service.hooks  
de.hybris.platform.notificationservices.service.impl  
de.hybris.platform.notificationservices.service.strategies  
de.hybris.platform.notificationservices.service.strategies.impl  
de.hybris.platform.notificationservices.strategies  
de.hybris.platform.notificationservices.strategies.impl  
de.hybris.platform.notificationservices.thread.factory  
de.hybris.platform.notificationservices.validators  
de.hybris.platform.oauth2  
de.hybris.platform.oauth2.constants  
de.hybris.platform.oauth2.controller  
de.hybris.platform.oauth2.data  
de.hybris.platform.oauth2.filter  
de.hybris.platform.oauth2.jalo  
de.hybris.platform.oauth2.json  
de.hybris.platform.oauth2.jwt.exceptions  
de.hybris.platform.oauth2.jwt.util  
de.hybris.platform.oauth2.model
Contains generated models for each type of de.hybris.platform.oauth2.jalo package.
de.hybris.platform.oauth2.provider.custom  
de.hybris.platform.oauth2.services  
de.hybris.platform.oauth2.services.impl  
de.hybris.platform.oauth2.services.impl.test  
de.hybris.platform.oauth2.util  
de.hybris.platform.odata2services  
de.hybris.platform.odata2services.config  
de.hybris.platform.odata2services.constants  
de.hybris.platform.odata2services.converter  
de.hybris.platform.odata2services.dto  
de.hybris.platform.odata2services.export  
de.hybris.platform.odata2services.export.impl  
de.hybris.platform.odata2services.filter  
de.hybris.platform.odata2services.filter.impl  
de.hybris.platform.odata2services.interceptor  
de.hybris.platform.odata2services.odata  
de.hybris.platform.odata2services.odata.asserts  
de.hybris.platform.odata2services.odata.content  
de.hybris.platform.odata2services.odata.errors  
de.hybris.platform.odata2services.odata.impl  
de.hybris.platform.odata2services.odata.integrationkey  
de.hybris.platform.odata2services.odata.integrationkey.impl  
de.hybris.platform.odata2services.odata.monitoring  
de.hybris.platform.odata2services.odata.monitoring.impl  
de.hybris.platform.odata2services.odata.persistence  
de.hybris.platform.odata2services.odata.persistence.creation  
de.hybris.platform.odata2services.odata.persistence.exception  
de.hybris.platform.odata2services.odata.persistence.hook  
de.hybris.platform.odata2services.odata.persistence.hook.impl  
de.hybris.platform.odata2services.odata.persistence.impl  
de.hybris.platform.odata2services.odata.persistence.lookup  
de.hybris.platform.odata2services.odata.persistence.populator  
de.hybris.platform.odata2services.odata.persistence.populator.processor  
de.hybris.platform.odata2services.odata.persistence.utils  
de.hybris.platform.odata2services.odata.persistence.validator  
de.hybris.platform.odata2services.odata.processor  
de.hybris.platform.odata2services.odata.processor.handler  
de.hybris.platform.odata2services.odata.processor.handler.delete  
de.hybris.platform.odata2services.odata.processor.handler.persistence  
de.hybris.platform.odata2services.odata.processor.handler.persistence.batch  
de.hybris.platform.odata2services.odata.processor.handler.read  
de.hybris.platform.odata2services.odata.processor.reader  
de.hybris.platform.odata2services.odata.processor.writer  
de.hybris.platform.odata2services.odata.schema  
de.hybris.platform.odata2services.odata.schema.association  
de.hybris.platform.odata2services.odata.schema.attribute  
de.hybris.platform.odata2services.odata.schema.entity  
de.hybris.platform.odata2services.odata.schema.navigation  
de.hybris.platform.odata2services.odata.schema.property  
de.hybris.platform.odata2services.odata.schema.utils  
de.hybris.platform.odata2services.odata.security  
de.hybris.platform.odata2services.odata.security.impl  
de.hybris.platform.odata2services.util  
de.hybris.platform.odata2webservices  
de.hybris.platform.odata2webservices.constants  
de.hybris.platform.odata2webservices.controller  
de.hybris.platform.odata2webservices.converter  
de.hybris.platform.odata2webservices.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.odata2webservices.facade  
de.hybris.platform.odata2webservices.facade.impl  
de.hybris.platform.odata2webservices.filters  
de.hybris.platform.odata2webservices.interceptor  
de.hybris.platform.odata2webservices.matchers  
de.hybris.platform.odata2webservices.odata  
de.hybris.platform.odata2webservices.odata.builders  
de.hybris.platform.odata2webservices.odata.impl  
de.hybris.platform.odata2webservices.odata.persistence.hooks  
de.hybris.platform.odata2webservices.update  
de.hybris.platform.odata2webservices.util  
de.hybris.platform.odata2webservicesfeaturetests  
de.hybris.platform.odata2webservicesfeaturetests.constants  
de.hybris.platform.odata2webservicesfeaturetests.enums
Contains generated models for each type of de.hybris.platform.jalo.enumeration package.
de.hybris.platform.odata2webservicesfeaturetests.jalo  
de.hybris.platform.odata2webservicesfeaturetests.model
Contains generated models for each type of de.hybris.platform.odata2webservicesfeaturetests.jalo package.
de.hybris.platform.odata2webservicesfeaturetests.useraccess  
de.hybris.platform.odata2webservicesfeaturetests.ws  
de.hybris.platform.omsbackoffice.actions.order  
de.hybris.platform.omsbackoffice.actions.order.cancel  
de.hybris.platform.omsbackoffice.actions.returns  
de.hybris.platform.omsbackoffice.config.impl.jaxb.hybris.customersupportrefineby  
de.hybris.platform.omsbackoffice.dto  
de.hybris.platform.omsbackoffice.renderers  
de.hybris.platform.omsbackoffice.widgets.customersupportrefineby  
de.hybris.platform.omsbackoffice.widgets.order.cancelorder  
de.hybris.platform.omsbackoffice.widgets.order.filter  
de.hybris.platform.omsbackoffice.widgets.order.orderprocessexecutor  
de.hybris.platform.omsbackoffice.widgets.returns.cancelreturnpopup  
de.hybris.platform.omsbackoffice.widgets.returns.createreturnrequest  
de.hybris.platform.omsbackoffice.widgets.returns.dtos  
de.hybris.platform.omsbackoffice.widgets.returns.filter  
de.hybris.platform.ondemandcommon.backoffice.helpers  
de.hybris.platform.ondemandcommon.backoffice.renderers  
de.hybris.platform.orbeonweb.constants  
de.hybris.platform.orbeonweb.jalo  
de.hybris.platform.order  
de.hybris.platform.order.calculation  
de.hybris.platform.order.daos  
de.hybris.platform.order.daos.impl  
de.hybris.platform.order.events  
de.hybris.platform.order.exceptions  
de.hybris.platform.order.impl  
de.hybris.platform.order.interceptors  
de.hybris.platform.order.jalo  
de.hybris.platform.order.model
Contains generated models for each type of de.hybris.platform.order.jalo package.
de.hybris.platform.order.strategies  
de.hybris.platform.order.strategies.calculation  
de.hybris.platform.order.strategies.calculation.impl  
de.hybris.platform.order.strategies.calculation.impl.internal  
de.hybris.platform.order.strategies.calculation.impl.servicelayer  
de.hybris.platform.order.strategies.calculation.pdt  
de.hybris.platform.order.strategies.calculation.pdt.comparator  
de.hybris.platform.order.strategies.calculation.pdt.comparator.impl  
de.hybris.platform.order.strategies.calculation.pdt.converter  
de.hybris.platform.order.strategies.calculation.pdt.converter.impl  
de.hybris.platform.order.strategies.calculation.pdt.criteria  
de.hybris.platform.order.strategies.calculation.pdt.criteria.impl  
de.hybris.platform.order.strategies.calculation.pdt.filter  
de.hybris.platform.order.strategies.calculation.pdt.filter.impl  
de.hybris.platform.order.strategies.calculation.pdt.impl  
de.hybris.platform.order.strategies.calculation.pdt.matcher  
de.hybris.platform.order.strategies.calculation.pdt.matcher.impl  
de.hybris.platform.order.strategies.calculation.pdt.postmatcher  
de.hybris.platform.order.strategies.calculation.pdt.postmatcher.impl  
de.hybris.platform.order.strategies.calculation.pdt.processor  
de.hybris.platform.order.strategies.calculation.pdt.processor.impl  
de.hybris.platform.order.strategies.calculation.pdt.query  
de.hybris.platform.order.strategies.calculation.pdt.query.impl  
de.hybris.platform.order.strategies.calculation.pdt.repository  
de.hybris.platform.order.strategies.calculation.pdt.repository.impl  
de.hybris.platform.order.strategies.deliveryzone  
de.hybris.platform.order.strategies.deliveryzone.impl  
de.hybris.platform.order.strategies.impl  
de.hybris.platform.order.strategies.ordercloning  
de.hybris.platform.order.strategies.ordercloning.impl  
de.hybris.platform.order.strategies.paymentinfo  
de.hybris.platform.order.strategies.paymentinfo.impl  
de.hybris.platform.order.strategies.saving  
de.hybris.platform.order.strategies.saving.impl  
de.hybris.platform.ordercancel  
de.hybris.platform.ordercancel.dao  
de.hybris.platform.ordercancel.dao.impl  
de.hybris.platform.ordercancel.events  
de.hybris.platform.ordercancel.exceptions  
de.hybris.platform.ordercancel.impl  
de.hybris.platform.ordercancel.impl.denialstrategies  
de.hybris.platform.ordercancel.impl.executors  
de.hybris.platform.ordercancel.impl.interceptor  
de.hybris.platform.ordercancel.impl.orderstatechangingstrategies  
de.hybris.platform.ordercancel.jalo  
de.hybris.platform.ordercancel.model
Contains generated models for each type of de.hybris.platform.ordercancel.jalo package.
de.hybris.platform.orderhandler  
de.hybris.platform.orderhistory  
de.hybris.platform.orderhistory.impl  
de.hybris.platform.orderhistory.jalo  
de.hybris.platform.orderhistory.jalo.mockups.actions  
de.hybris.platform.orderhistory.model
Contains generated models for each type of de.hybris.platform.orderhistory.jalo package.
de.hybris.platform.ordermanagementaddon.constants  
de.hybris.platform.ordermanagementaddon.controllers  
de.hybris.platform.ordermanagementaddon.jalo  
de.hybris.platform.ordermanagementaddon.setup  
de.hybris.platform.ordermanagementfacades  
de.hybris.platform.ordermanagementfacades.cancellation.data  
de.hybris.platform.ordermanagementfacades.constants  
de.hybris.platform.ordermanagementfacades.fraud.converters.populator  
de.hybris.platform.ordermanagementfacades.fraud.data  
de.hybris.platform.ordermanagementfacades.jalo  
de.hybris.platform.ordermanagementfacades.order  
de.hybris.platform.ordermanagementfacades.order.cancel  
de.hybris.platform.ordermanagementfacades.order.converters.populator  
de.hybris.platform.ordermanagementfacades.order.data  
de.hybris.platform.ordermanagementfacades.order.impl  
de.hybris.platform.ordermanagementfacades.payment.converters.populator  
de.hybris.platform.ordermanagementfacades.payment.data  
de.hybris.platform.ordermanagementfacades.product.converters.populator  
de.hybris.platform.ordermanagementfacades.returns  
de.hybris.platform.ordermanagementfacades.returns.converters.populator  
de.hybris.platform.ordermanagementfacades.returns.data  
de.hybris.platform.ordermanagementfacades.returns.impl  
de.hybris.platform.ordermanagementfacades.search.dao.impl  
de.hybris.platform.ordermanagementfacades.workflow  
de.hybris.platform.ordermanagementfacades.workflow.converters.populator  
de.hybris.platform.ordermanagementfacades.workflow.data  
de.hybris.platform.ordermanagementfacades.workflow.impl  
de.hybris.platform.ordermanagementwebservices.config  
de.hybris.platform.ordermanagementwebservices.constants  
de.hybris.platform.ordermanagementwebservices.controllers  
de.hybris.platform.ordermanagementwebservices.controllers.order  
de.hybris.platform.ordermanagementwebservices.controllers.returns  
de.hybris.platform.ordermanagementwebservices.controllers.workflow  
de.hybris.platform.ordermanagementwebservices.dto.fraud  
de.hybris.platform.ordermanagementwebservices.dto.order  
de.hybris.platform.ordermanagementwebservices.dto.payment  
de.hybris.platform.ordermanagementwebservices.dto.returns  
de.hybris.platform.ordermanagementwebservices.dto.workflow  
de.hybris.platform.ordermanagementwebservices.jalo  
de.hybris.platform.ordermanagementwebservices.mapping.converters.returns  
de.hybris.platform.ordermanagementwebservices.util  
de.hybris.platform.ordermanagementwebservices.validators  
de.hybris.platform.ordermodify.impl  
de.hybris.platform.ordermodify.jalo  
de.hybris.platform.o